DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and PRSS33

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:272 Identity:94/272 - (34%)
Similarity:138/272 - (50%) Gaps:31/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILVILEASRTE---AAVPRQP--DSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITA 75
            :|::|.|:.|:   :|...||  .||||.||:..:|::|:|.|::.:..|:||.|:::..|.:||
Human    11 LLLVLGAAGTQGRKSAACGQPRMSSRIVGGRDGRDGEWPWQASIQHRGAHVCGGSLIAPQWVLTA 75

  Fly    76 AHCIDGHEQQPREFTLRQGSIM--RTSGGTVQ-PVKAIYKHPAYDRADMNFDVALLRTADGALSL 137
            |||.. ....|.|:.:|.|::.  .||..|:. ||:.:...|.|.......|:|||:.   ...:
Human    76 AHCFP-RRALPAEYRVRLGALRLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQL---RRPV 136

  Fly   138 PL-GKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLS-SVLKSTTVLTVNQEKCHNDLRHHG 200
            || .:|.|:.||..|.......|..|:|||.:....|:.. ..|:...|..::...| :.|.|.|
Human   137 PLSARVQPVCLPVPGARPPPGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTC-DGLYHVG 200

  Fly   201 G--------VTEAMFCAA--ARNTDACQGDSGGPI----SAQGTLIGIVSWGVGCADPYYPGVYT 251
            .        |.....||.  ..:.||||||||||:    |....|:|:||||.|||.|..|||||
Human   201 ADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYT 265

  Fly   252 RLAHPTIRRWIR 263
            .:|  |...||:
Human   266 SVA--TYSPWIQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 84/244 (34%)
Tryp_SPc 37..263 CDD:238113 84/244 (34%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 84/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.