DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Prss1

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_036767.1 Gene:Prss1 / 24691 RGDID:3417 Length:246 Species:Rattus norvegicus


Alignment Length:262 Identity:90/262 - (34%)
Similarity:127/262 - (48%) Gaps:40/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDG 81
            |:||.......|.|.:.|.:||.|....|...|||:|| ....|.||.|:::..|.::||||...
  Rat     4 LLILALVGAAVAFPLEDDDKIVGGYTCPEHSVPYQVSL-NSGYHFCGGSLINDQWVVSAAHCYKS 67

  Fly    82 HEQQPREFTLRQGS-IMRTSGGTVQPVKA--IYKHPAYDRADMNFDVALLRTADGALSLPL---G 140
            ..|      :|.|. .:....|..|.:.|  |.|||.|....:|.|:.|::     ||.|:   .
  Rat    68 RIQ------VRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIK-----LSSPVKLNA 121

  Fly   141 KVAPIRLPTVGEAISESMPA----VVSGWGHM---STSNPVLSSVLKSTTVLTVNQEKCHNDLRH 198
            :|||:.||      |...||    ::||||:.   ..:||   .:|:......::|..|  :..:
  Rat   122 RVAPVALP------SACAPAGTQCLISGWGNTLSNGVNNP---DLLQCVDAPVLSQADC--EAAY 175

  Fly   199 HGGVTEAMFCAA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRW 261
            .|.:|.:|.|..  ....|:||||||||:...|.|.||||||.|||.|..|||||::.:  ...|
  Rat   176 PGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCN--FVGW 238

  Fly   262 IR 263
            |:
  Rat   239 IQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 82/240 (34%)
Tryp_SPc 37..263 CDD:238113 83/240 (35%)
Prss1NP_036767.1 Tryp_SPc 23..239 CDD:214473 82/240 (34%)
Tryp_SPc 24..242 CDD:238113 84/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.