DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and TPSD1

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:254 Identity:78/254 - (30%)
Similarity:112/254 - (44%) Gaps:45/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AP--IPFLLIAGILVILEASRTEAAVPRQ--PDSRIVNGREATEGQFPYQLSLRRQ---TVHICG 63
            ||  :..||:|  |.:|.:....|..|.|  ..:.||.|:||...::|:|:|||.:   .:|.||
Human     5 APQMLSLLLLA--LPVLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMHFCG 67

  Fly    64 ASILSSNWAITAAHCI--DGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVA 126
            .|::...|.:|||||:  |..:.......||:..:....  .:.||..|..||.:.......|:|
Human    68 GSLIHPQWVLTAAHCVEPDIKDLAALRVQLREQHLYYQD--QLLPVSRIIVHPQFYIIQTGADIA 130

  Fly   127 LLRTADGALSLPL---GKVAPIRLPTVGEAISESMPAVVSGWG------HMSTSNPVLSSVLKST 182
            ||.     |..|:   ..:..:.||...|.....||..|:|||      |:....|     ||..
Human   131 LLE-----LEEPVNISSHIHTVTLPPASETFPPGMPCWVTGWGDVDNNVHLPPPYP-----LKEV 185

  Fly   183 TVLTVNQEKCHNDLRHHGG---------VTEAMFCAAARNTDACQGDSGGPI--SAQGT 230
            .|..|....|:.:  :|.|         |.:.|.||.:.|.|:||||||||:  ...||
Human   186 EVPVVENHLCNAE--YHTGLHTGHSFQIVRDDMLCAGSENHDSCQGDSGGPLVCKVNGT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 68/220 (31%)
Tryp_SPc 37..263 CDD:238113 68/219 (31%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 66/217 (30%)
Tryp_SPc 38..240 CDD:214473 66/215 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7244
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.