DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Prss2

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_033456.1 Gene:Prss2 / 22072 MGIID:102759 Length:246 Species:Mus musculus


Alignment Length:275 Identity:85/275 - (30%)
Similarity:123/275 - (44%) Gaps:66/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHC--- 78
            |:||.......|.|...|.:||.|....|...|||:|| ....|.||.|:::..|.::||||   
Mouse     4 LLILALVGAAVAFPVDDDDKIVGGYTCRESSVPYQVSL-NAGYHFCGGSLINDQWVVSAAHCYKY 67

  Fly    79 -------------IDGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRT 130
                         ::|:||                  .|...| |.:||.|:...::.|:.|:: 
Mouse    68 RIQVRLGEHNINVLEGNEQ------------------FVDSAK-IIRHPNYNSWTLDNDIMLIK- 112

  Fly   131 ADGALSLPL---GKVAPIRLPTVGEAISESMPA----VVSGWGHM---STSNPVLSSVLKSTTVL 185
                |:.|:   .:||.:.||      |...||    ::||||:.   ..:||   .:|:.....
Mouse   113 ----LASPVTLNARVASVPLP------SSCAPAGTQCLISGWGNTLSNGVNNP---DLLQCVDAP 164

  Fly   186 TVNQEKCHNDLRHHGGVTEAMFCAA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPG 248
            .:.|..|  :..:.|.:|..|.|..  ....|:||||||||:...|.|.||||||.|||.|..||
Mouse   165 VLPQADC--EASYPGDITNNMICVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQPDAPG 227

  Fly   249 VYTRLAHPTIRRWIR 263
            |||::.:..  .||:
Mouse   228 VYTKVCNYV--DWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 77/253 (30%)
Tryp_SPc 37..263 CDD:238113 78/253 (31%)
Prss2NP_033456.1 Tryp_SPc 23..239 CDD:214473 77/253 (30%)
Tryp_SPc 24..242 CDD:238113 79/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.