DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Prss38

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:291 Identity:81/291 - (27%)
Similarity:127/291 - (43%) Gaps:61/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIAGILVILEASRTEAAVPRQPDS------------------RIVNGREATEGQFPYQLSLRRQ 57
            ||:|....:...||      |.|.|                  :::.|..|.:.::|:|:||...
Mouse    18 LLLASPTWVTSVSR------RHPKSQANSLSGDVACGQPVLQGKLLGGEFARDRKWPWQVSLHYS 76

  Fly    58 TVHICGASILSSNWAITAAHCID-GHEQQPREFTLRQGSIMRTSGGT---------VQPVKAIYK 112
            ..||||.||||:.|.::||||.| |.:.:..:..:...::.:.:..|         :.|...:| 
Mouse    77 GFHICGGSILSAYWVLSAAHCFDRGKKLETYDIYVGITNLEKANRHTQWFEIYQVIIHPTFQMY- 140

  Fly   113 HPAYDRADMNFDVALLRTADGALSLPLGKVAPIRLPTVGEAISESMPAVVSGWGHMS----TSNP 173
            ||      :..||||::.....:....  |.||.||. .:....::....:|||.:|    |.|.
Mouse   141 HP------IGGDVALVQLKSAIVFSDF--VLPICLPP-SDLYLINLSCWTTGWGMISPQGETGNE 196

  Fly   174 VLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAAARNT--DACQGDSGGPISAQGT----LI 232
            :|.:.|.     .:.:.:|.........:...|.|||...|  :.|:||||.|:..:..    .|
Mouse   197 LLEAQLP-----LIPRFQCQLLYGLSSYLLPEMLCAADIKTMKNVCEGDSGSPLVCKQNQTWLQI 256

  Fly   233 GIVSWGVGCADPYYPGVYTRLAHPTIRRWIR 263
            ||||||.|||.|.||||:..:::  ...|||
Mouse   257 GIVSWGRGCAQPLYPGVFANVSY--FLSWIR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 70/245 (29%)
Tryp_SPc 37..263 CDD:238113 71/245 (29%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 73/245 (30%)
Tryp_SPc 58..284 CDD:214473 70/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.