DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Masp2

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001003893.1 Gene:Masp2 / 17175 MGIID:1330832 Length:685 Species:Mus musculus


Alignment Length:242 Identity:76/242 - (31%)
Similarity:109/242 - (45%) Gaps:37/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREFTLRQGSIMRTS 100
            |||.|:.|..|.||:|:.|..||....|| ::..||.:||||.:...........:|.|.:.|.|
Mouse   443 RIVGGQPAKPGDFPWQVLLLGQTTAAAGA-LIHDNWVLTAAHAVYEKRMAASSLNIRMGILKRLS 506

  Fly   101 GGTVQP-VKAIYKHPAYDR-ADMNFDVALLR-----TADGALSLPLGKVAPIRLPTVGEAIS--- 155
            ....|. .:.|:.|..|.. |..:.|:||::     |.:|:       :.|:.||. .||.|   
Mouse   507 PHYTQAWPEEIFIHEGYTHGAGFDNDIALIKLKNKVTINGS-------IMPVCLPR-KEAASLMR 563

  Fly   156 ESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKC---HNDLRHHGGVTEAMFCAAAR--NTD 215
            ......|:|||  .|...:|:..|....:...:.:||   :..|.....|:..|.||...  ..|
Mouse   564 TDFTGTVAGWG--LTQKGLLARNLMFVDIPIADHQKCTAVYEKLYPGVRVSANMLCAGLETGGKD 626

  Fly   216 ACQGDSGGPI-----SAQGTLI-GIVSWG---VGCADPYYPGVYTRL 253
            :|:|||||.:     ..|...: ||||||   .|.||.|  ||||::
Mouse   627 SCRGDSGGALVFLDNETQRWFVGGIVSWGSINCGAADQY--GVYTKV 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 76/242 (31%)
Tryp_SPc 37..263 CDD:238113 75/241 (31%)
Masp2NP_001003893.1 CUB 19..136 CDD:238001
FXa_inhibition 152..180 CDD:291342
CUB 184..293 CDD:278839
Sushi 300..361 CDD:278512
Sushi 366..429 CDD:278512
Tryp_SPc 443..678 CDD:214473 76/242 (31%)
Tryp_SPc 444..681 CDD:238113 75/241 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.