DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and PRSS36

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:287 Identity:83/287 - (28%)
Similarity:127/287 - (44%) Gaps:38/287 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIAGILVILE----ASRTEAAVPRQ------------PDSRIVNGREATEGQFPYQLSLRRQTV 59
            ||:..:::::.    |.:..|..|.|            |.:|||.|..|..|.:|:|:||.....
Human     5 LLLPLVMLVISPIPGAFQDSALSPTQEEPEDLDCGRPEPSARIVGGSNAQPGTWPWQVSLHHGGG 69

  Fly    60 HICGASILSSNWAITAAHCI--DGHEQQPREFTLRQGSIMR---TSGGTVQPVKAIYKHPAYDRA 119
            ||||.|:::.:|.::||||.  :|..:...|:::..|...:   ..|...:.|.||.....|.:.
Human    70 HICGGSLIAPSWVLSAAHCFMTNGTLEPAAEWSVLLGVHSQDGPLDGAHTRAVAAIVVPANYSQV 134

  Fly   120 DMNFDVALLRTADGALSLPLGKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPV-LSSVLKSTT 183
            ::..|:||||.|..|...|  .|.|:.||..............:|||.:..::|: |..||:...
Human   135 ELGADLALLRLASPASLGP--AVWPVCLPRASHRFVHGTACWATGWGDVQEADPLPLPWVLQEVE 197

  Fly   184 VLTVNQEKCHNDLRHHG------GVTEAMFCAA--ARNTDACQGDSGGPI----SAQGTLIGIVS 236
            :..:.:..|.......|      .:...|.||.  ....|.||||||||:    ..:....||.|
Human   198 LRLLGEATCQCLYSQPGPFNLTLQILPGMLCAGYPEGRRDTCQGDSGGPLVCEEGGRWFQAGITS 262

  Fly   237 WGVGCADPYYPGVYTRLAHPTIRRWIR 263
            :|.||.....|||:|.:|  |...|||
Human   263 FGFGCGRRNRPGVFTAVA--TYEAWIR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 73/243 (30%)
Tryp_SPc 37..263 CDD:238113 73/243 (30%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 73/243 (30%)
Tryp_SPc 47..289 CDD:238113 75/245 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149401
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.