DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Prss1

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_444473.1 Gene:Prss1 / 114228 MGIID:98839 Length:246 Species:Mus musculus


Alignment Length:269 Identity:92/269 - (34%)
Similarity:126/269 - (46%) Gaps:49/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAIT 74
            ||.:.|..|         |.|...|.:||.|....|...|||:|| ....|.||.|:::..|.::
Mouse     6 FLALVGAAV---------AFPVDDDDKIVGGYTCRENSVPYQVSL-NSGYHFCGGSLINDQWVVS 60

  Fly    75 AAHCIDGHEQQPREFTLRQGS-IMRTSGGTVQPVKA--IYKHPAYDRADMNFDVALLRTADGALS 136
            ||||.....|      :|.|. .:....|..|.:.|  |.|||.::|..:|.|:.|::     ||
Mouse    61 AAHCYKTRIQ------VRLGEHNINVLEGNEQFIDAAKIIKHPNFNRKTLNNDIMLIK-----LS 114

  Fly   137 LPL---GKVAPIRLPTVGEAISESMPA----VVSGWGH---MSTSNPVLSSVLKSTTVLTVNQEK 191
            .|:   .:||.:.||      |...||    ::||||:   ...|.|.|...|.:.   .:.|..
Mouse   115 SPVTLNARVATVALP------SSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAP---LLPQAD 170

  Fly   192 CHNDLRHHGGVTEAMFCAA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLA 254
            |  :..:.|.:|..|.||.  ....|:||||||||:...|.|.||||||.|||.|..|||||::.
Mouse   171 C--EASYPGKITGNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVC 233

  Fly   255 HPTIRRWIR 263
            :..  .||:
Mouse   234 NYV--DWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 83/240 (35%)
Tryp_SPc 37..263 CDD:238113 84/240 (35%)
Prss1NP_444473.1 Tryp_SPc 23..239 CDD:214473 83/240 (35%)
Tryp_SPc 24..242 CDD:238113 85/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.