DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and PRSS21

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:292 Identity:94/292 - (32%)
Similarity:133/292 - (45%) Gaps:51/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIAGILVI--LEASRTEAAVP-------RQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASI 66
            ||:|.:|..  |....::.|.|       |...||||.|.:|..|::|:|.|||....|:||.|:
Human     7 LLLALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSL 71

  Fly    67 LSSNWAITAAHCIDGHE--QQPREFTLRQGSIMRTSGGTVQP-------------VKAIYKHPAY 116
            ||..||:|||||.:.:.  ..|..:.::.|.:      |..|             |..||..|.|
Human    72 LSHRWALTAAHCFETYSDLSDPSGWMVQFGQL------TSMPSFWSLQAYYTRYFVSNIYLSPRY 130

  Fly   117 DRADMNFDVALLRTADGALSLPL---GKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLS-S 177
             ..:..:|:||::     ||.|:   ..:.||.|..............|:|||::.....:.| .
Human   131 -LGNSPYDIALVK-----LSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPH 189

  Fly   178 VLKSTTVLTVNQEKC-HNDLRH--HGGVTEAMFCA--AARNTDACQGDSGGPISAQGT----LIG 233
            .|:...|..:|...| |..|::  ...:...|.||  |....|||.||||||::....    .||
Human   190 TLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIG 254

  Fly   234 IVSWGVGCADPYYPGVYTRLAHPTIRRWIRLL 265
            :|||||||..|..|||||.::|..  .||:.|
Human   255 VVSWGVGCGRPNRPGVYTNISHHF--EWIQKL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 82/253 (32%)
Tryp_SPc 37..263 CDD:238113 82/253 (32%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 83/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.