DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and LOC105945797

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_031761518.1 Gene:LOC105945797 / 105945797 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:234 Identity:77/234 - (32%)
Similarity:119/234 - (50%) Gaps:20/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREFTLRQGSIMR 98
            |.:||.|........||.:|| ....|.||.|::||.|.::||||.    ....|..|.:..|..
 Frog    18 DDKIVGGYTCAPNSVPYIVSL-NAGYHFCGGSLISSQWVVSAAHCF----MNKIEVRLGEHDIKA 77

  Fly    99 TSGGTVQPVKA--IYKHPAYDRADMNFDVALLRTADGALSLPLGK-VAPIRLPTVGEAISESMPA 160
            |. ||.|.:.:  :.|:..|....::.|:.|::.|..|:   |.: |:|:.||:  ..|......
 Frog    78 TE-GTEQFINSAKVIKNKGYSPRTLDNDIMLIKLATPAI---LNQYVSPVPLPS--GCIEPRANC 136

  Fly   161 VVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAA--ARNTDACQGDSGG 223
            ::||||:..:|.....::|:..:...:..::|:.  .:.|.:|:.|.|..  ....|:|||||||
 Frog   137 LISGWGNTLSSGSNYPNLLQCVSAPVLTADECNK--AYPGEITQNMICVGFLEGGKDSCQGDSGG 199

  Fly   224 PISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWI 262
            |:...|.|.||||||.|||:..||||||::.:  ...||
 Frog   200 PVVCNGELQGIVSWGYGCAEKNYPGVYTKVCN--YNAWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 74/230 (32%)
Tryp_SPc 37..263 CDD:238113 76/231 (33%)
LOC105945797XP_031761518.1 Tryp_SPc 21..239 CDD:238113 76/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.