DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and LOC102554637

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_017448472.2 Gene:LOC102554637 / 102554637 RGDID:7618053 Length:246 Species:Rattus norvegicus


Alignment Length:263 Identity:92/263 - (34%)
Similarity:129/263 - (49%) Gaps:43/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCID 80
            :||::.|:   .|.|...|.:||.|....|...|||:|| ....|.||.|:::..|.::||||..
  Rat     6 VLVLVGAA---VAFPVDDDDKIVGGYTCQEHSVPYQVSL-NSGYHYCGGSLINDQWVVSAAHCYK 66

  Fly    81 GHEQQPREFTLRQGS-IMRTSGGTVQPVKA--IYKHPAYDRADMNFDVALLRTADGALSLPL--- 139
            ...|      :|.|. .:....|..|.|.|  |.|||.:||..:|.|:.|::     ||.|:   
  Rat    67 SRIQ------VRLGEHNINVLEGDEQFVNAAKIIKHPNFDRKTLNNDIMLIK-----LSSPVKLN 120

  Fly   140 GKVAPIRLPTVGEAISESMPA----VVSGWGH---MSTSNPVLSSVLKSTTVLTVNQEKCHNDLR 197
            .:||.:.||      |...||    ::||||:   ...::|.|...|.:.   .:.|..|  :..
  Rat   121 ARVATVALP------SSCAPAGTQCLISGWGNTLSFGVNDPDLLQCLDAP---LLPQADC--EAS 174

  Fly   198 HHGGVTEAMFCAA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRR 260
            :.|.:|..|.||.  ....|:||||||||:...|.|.||||||.|||.|..|||||::.:..  .
  Rat   175 YPGKITNNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYV--D 237

  Fly   261 WIR 263
            ||:
  Rat   238 WIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 84/240 (35%)
Tryp_SPc 37..263 CDD:238113 85/240 (35%)
LOC102554637XP_017448472.2 Tryp_SPc 24..242 CDD:238113 86/242 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.