DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and zgc:165423

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:260 Identity:84/260 - (32%)
Similarity:132/260 - (50%) Gaps:31/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EASRTEAAVPRQP-DSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQ 84
            :.:::..|..:.| :::||.|..|:.|.:|:|.||.....|.||.|::|..|.::||||...: .
Zfish    21 QPTQSPPACGKAPLNTKIVGGTNASAGSWPWQASLHESGSHFCGGSLISDQWILSAAHCFPSN-P 84

  Fly    85 QPREFTL---RQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPL---GKVA 143
            .|.::|:   ||...:.......:.|..:..||.|..:..:.|:|||.     ||.|:   ..:.
Zfish    85 NPSDYTVYLGRQSQDLPNPNEVSKSVSQVIVHPLYQGSTHDNDMALLH-----LSSPVTFSNYIQ 144

  Fly   144 PIRLPTVGEAI-SESMPAVVSGWGHMSTSNPVLS-SVLKSTTVLTVNQEKCHNDLRHHGG---VT 203
            |:.|...|... :::|  .::|||.:.:...:.| .:|:...|..|....| |.|  :||   :|
Zfish   145 PVCLAADGSTFYNDTM--WITGWGTIESGVSLPSPQILQEVNVPIVGNNLC-NCL--YGGGSSIT 204

  Fly   204 EAMFCAAAR--NTDACQGDSGGP--ISAQGTLI--GIVSWGVGCADPYYPGVYTRLAHPTIRRWI 262
            ..|.||...  ..|:||||||||  |.:..|.:  |:||:|.|||||.|||||.|::.  .:.||
Zfish   205 NNMMCAGLMQGGKDSCQGDSGGPMVIKSFNTWVQAGVVSFGKGCADPNYPGVYARVSQ--YQNWI 267

  Fly   263  262
            Zfish   268  267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 80/242 (33%)
Tryp_SPc 37..263 CDD:238113 82/243 (34%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 80/242 (33%)
Tryp_SPc 38..269 CDD:238113 82/243 (34%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.