DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Gm10334

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001096623.1 Gene:Gm10334 / 100040233 MGIID:3641889 Length:246 Species:Mus musculus


Alignment Length:263 Identity:92/263 - (34%)
Similarity:127/263 - (48%) Gaps:43/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCID 80
            ||.::.|:   .|.|...|.:||.|....|...|||:|| ....|.||.|:::..|.::||||..
Mouse     6 ILALVGAA---VAFPVDDDDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSAAHCYK 66

  Fly    81 GHEQQPREFTLRQGS-IMRTSGGTVQPVKA--IYKHPAYDRADMNFDVALLRTADGALSLPL--- 139
            ...|      :|.|. .:....|..|.|.|  |.|||.::|..:|.|:.|::     ||.|:   
Mouse    67 TRIQ------VRLGEHNINVLEGNEQFVNAAKIIKHPNFNRKTLNNDIMLIK-----LSSPVTLN 120

  Fly   140 GKVAPIRLPTVGEAISESMPA----VVSGWGH---MSTSNPVLSSVLKSTTVLTVNQEKCHNDLR 197
            .:||.:.||      |...||    ::||||:   ...|.|.|...|.:.   .:.|..|  :..
Mouse   121 ARVATVALP------SSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAP---LLPQADC--EAS 174

  Fly   198 HHGGVTEAMFCAA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRR 260
            :.|.:|..|.||.  ....|:||||||||:...|.|.||||||.|||.|..|||||::.:..  .
Mouse   175 YPGKITGNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYV--D 237

  Fly   261 WIR 263
            ||:
Mouse   238 WIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 84/240 (35%)
Tryp_SPc 37..263 CDD:238113 85/240 (35%)
Gm10334NP_001096623.1 Tryp_SPc 24..242 CDD:238113 86/242 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.