DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Gm2663

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001096130.1 Gene:Gm2663 / 100040208 MGIID:3780832 Length:247 Species:Mus musculus


Alignment Length:242 Identity:75/242 - (30%)
Similarity:117/242 - (48%) Gaps:21/242 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREFTLR 92
            |:|...|.:||.|....:...|||:||.....|.||.|:::..|.::||||      ..|...:|
Mouse    15 ALPANSDDKIVGGYTCPKHSVPYQVSLNDGISHQCGGSLINDQWVLSAAHC------YKRRLQVR 73

  Fly    93 QG--SIMRTSGGTVQPVKA--IYKHPAYDRADMNFDVALLRTADGALSLPLGKVAPIRLPTVGEA 153
            .|  :|....||. |.:.|  |.:||.|::..::.|:.|::....|:.  ..:|:.:.||.  ..
Mouse    74 LGEHNIDVLEGGE-QFIDAEKIIRHPDYNKDTVDNDIMLIKLKSPAIL--NSQVSTVSLPR--SC 133

  Fly   154 ISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAA--ARNTDA 216
            .|.:...:|||||:..:......::|:......::...|...  :.|.:|..|||..  ....|:
Mouse   134 ASTNAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKS--YPGQITSNMFCLGFLEGGKDS 196

  Fly   217 CQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIR 263
            |.||||||:...|.:.||||||..||....|||||::.:  ...||:
Mouse   197 CDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCN--YLSWIQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 70/231 (30%)
Tryp_SPc 37..263 CDD:238113 71/231 (31%)
Gm2663NP_001096130.1 Tryp_SPc 23..240 CDD:214473 70/231 (30%)
Tryp_SPc 24..243 CDD:238113 72/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.