DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and KIC1

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_011970.1 Gene:KIC1 / 856502 SGDID:S000001144 Length:1080 Species:Saccharomyces cerevisiae


Alignment Length:262 Identity:91/262 - (34%)
Similarity:147/262 - (56%) Gaps:7/262 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 DPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSK-DLILTEIRVLKDFNH-KNL 350
            |....:|.|:.:|:|..|:|:...:::.....|:|.:::.:.|.: :.:..||:.|..... .|:
Yeast    18 DVSSLFKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNI 82

  Fly   351 VNFLDAYLLEPEDQLWVVMEYMDGGPLTDVVTETVMKERQIACVCRETLYAISFLHAKGIIHRDI 415
            ..:..:||  .:..||::||:..||.|..::....:.|:.|..:.||.|.|:..:|...:|||||
Yeast    83 TRYYGSYL--KDTSLWIIMEHCAGGSLRSLLRPGKIDEKYIGVIMRELLVALKCIHKDNVIHRDI 145

  Fly   416 KSDNVLLGMDGSVKVTDFGFCANI-EGDEKRQTMVGTPYWMAPEVVTR-KKYGKKVDIWSIGIMA 478
            |:.|||:..:|:||:.|||..|.: :...:||||.||||||||||:.. ..|..||||||:||..
Yeast   146 KAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITT 210

  Fly   479 IEMIEGQPPYLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHP 543
            .|:..|.|||.....|||:.||..:..|.::. ...|.:|::|:..||..:...|.:||:||...
Yeast   211 YEIATGNPPYCDVEALRAMQLIIKSKPPRLED-RSYSTSLKEFIALCLDEDPKERLSADDLLKSK 274

  Fly   544 FL 545
            |:
Yeast   275 FI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 90/260 (35%)
S_TKc 293..545 CDD:214567 89/255 (35%)
KIC1NP_011970.1 STKc_NAK1_like 21..295 CDD:270822 90/259 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.