DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and SSK22

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_009998.2 Gene:SSK22 / 850436 SGDID:S000000669 Length:1331 Species:Saccharomyces cerevisiae


Alignment Length:375 Identity:100/375 - (26%)
Similarity:174/375 - (46%) Gaps:66/375 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 EDSDNQHKINTDTIIIKPAVGAQDAGADDNPDE-------TILRRSKEKRAQKTDAEIYVELRAI 283
            |:...|.::|.||              ::|.||       :.||....|..:||......::..:
Yeast   959 ENGMQQARLNIDT--------------EENIDEEATLEINSRLRLEAIKTLEKTMKRNPRQMGKV 1009

  Fly   284 CNSDDPRERY---------------KTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSK- 332
            .::.|...:|               :....:|.|..|.|:.|.:|:|...:|||.|.:.:.::. 
Yeast  1010 LDATDQGNKYLLSLASSLSNVSMRWQKRSFIGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMK 1074

  Fly   333 ---DLILTEIRVLKDFNHKNLVNFLDAYLLE-PEDQLWVVMEYMDGGPLTDVVTETVMKERQIAC 393
               .||..|:.||:..||.|:|.:   |.:| ..|::.:.|||.:||.|..::....:::..:..
Yeast  1075 KIFPLIKEEMTVLEMLNHPNIVQY---YGVEVHRDKVNIFMEYCEGGSLASLLDHGRIEDEMVTQ 1136

  Fly   394 VCR-ETLYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANIEGDEKR------------ 445
            |.. |.|..:::||..|::|||||.:|:||..:|.:|..|||....:.|...|            
Yeast  1137 VYTFELLEGLAYLHQSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGV 1201

  Fly   446 -----QTMVGTPYWMAPEVVTRKKYGKKV---DIWSIGIMAIEMIEGQPPYL-YETPLRALYLIA 501
                 ..|:|||.:||||.::......|:   |:|::|.:.:||..|:.|:. .:.....:|.:|
Yeast  1202 ETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWAIMYHVA 1266

  Fly   502 ANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFLNDCSEV 551
            |...|.:.:.|:::...:.||:|||..:...||||.|||..|::....|:
Yeast  1267 AGRIPQLPNRDEMTAAGRAFLERCLVQDPTMRATAVELLIDPWMIQIREI 1316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 86/298 (29%)
S_TKc 293..545 CDD:214567 85/293 (29%)
SSK22NP_009998.2 STKc_MEKK4 1033..1309 CDD:270796 83/278 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.