DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and MKK9

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_177492.1 Gene:MKK9 / 843685 AraportID:AT1G73500 Length:310 Species:Arabidopsis thaliana


Alignment Length:276 Identity:80/276 - (28%)
Similarity:128/276 - (46%) Gaps:47/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 VGKGASGIVFIAADLQNESQVAVKTI--DMKNQSSKDLILTEIRVLKDFNHKNLVNFLDAYLLEP 361
            :|.|..|||:...........|:||:  ||....::.| :.|:.:|:..:...:|.....:....
plant    53 LGCGNGGIVYKVRHKTTSEIYALKTVNGDMDPIFTRQL-MREMEILRRTDSPYVVKCHGIFEKPV 116

  Fly   362 EDQLWVVMEYMDGGPLTDV---VTETVMKERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLG 423
            ..::.::|||||||.|..:   ||     |:::|...::.|..:|:|||..|:|||||..|:||.
plant   117 VGEVSILMEYMDGGTLESLRGGVT-----EQKLAGFAKQILKGLSYLHALKIVHRDIKPANLLLN 176

  Fly   424 MDGSVKVTDFGFC-ANIEGDEKRQTMVGTPYWMAPEVVTRKKYGKKV-----DIWSIGIMAIEMI 482
            ....||:.|||.. ..:...:...:.|||..:|:||....:..|...     ||||.|:|.:|::
plant   177 SKNEVKIADFGVSKILVRSLDSCNSYVGTCAYMSPERFDSESSGGSSDIYAGDIWSFGLMMLELL 241

  Fly   483 EGQPPYLYETPLRALYLIAANGRPDIKSWDKL----------------SPNLQDFLDRCLQVEVD 531
            .|..|           |:....|||   |..|                |...:.|::.||:.:..
plant   242 VGHFP-----------LLPPGQRPD---WATLMCAVCFGEPPRAPEGCSEEFRSFVECCLRKDSS 292

  Fly   532 RRATADELLSHPFLND 547
            :|.||.:||:||||.:
plant   293 KRWTAPQLLAHPFLRE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 78/272 (29%)
S_TKc 293..545 CDD:214567 78/272 (29%)
MKK9NP_177492.1 PKc_MAPKK_plant_like 46..308 CDD:132954 80/274 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.