DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and MAPKKK15

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001330365.1 Gene:MAPKKK15 / 835600 AraportID:AT5G55090 Length:510 Species:Arabidopsis thaliana


Alignment Length:318 Identity:93/318 - (29%)
Similarity:157/318 - (49%) Gaps:25/318 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 YVELRAICNSDDPRERYKTTQEVGKGASGIVFIAADLQNESQ-VAVKTIDMKNQSSKDLILTEIR 340
            :|.|...|:.....:.:.....:|:|::..|.:.  :.|... .|||:.:.   ||...:..|..
plant    52 FVPLFFSCSVSMEEQNWIRGPIIGRGSTATVSLG--ITNSGDFFAVKSAEF---SSSAFLQREQS 111

  Fly   341 VLKDFNHKNLVNFLDAYLLEPEDQLW--VVMEYMDGGPLTDVVTET--VMKERQIACVCRETLYA 401
            :|...:...:|.::.:.:.:..|:|.  ::|||:.||.|.|::..:  .:.|..|....|:.|..
plant   112 ILSKLSSPYIVKYIGSNVTKENDKLMYNLLMEYVSGGSLHDLIKNSGGKLPEPLIRSYTRQILKG 176

  Fly   402 ISFLHAKGIIHRDIKSDNVLLGMDGSV-KVTDFGFCANIEGDEKRQTMVGTPYWMAPEVVTRKKY 465
            :.:||.:||:|.|:||.||::|  |.: |:.|.|....:|.:|..: ..|||.:|:|||...::.
plant   177 LMYLHDQGIVHCDVKSQNVMIG--GEIAKIVDLGCAKTVEENENLE-FSGTPAFMSPEVARGEEQ 238

  Fly   466 GKKVDIWSIGIMAIEMIEGQPPY--LYETPLRALYLIAANGR-PDIKSWDKLSPNLQDFLDRCLQ 527
            ....|:|::|...|||..|..|:  |.:. :.|:|.|...|. |.|..|  ||...||||.:||:
plant   239 SFPADVWALGCTVIEMATGSSPWPELNDV-VAAIYKIGFTGESPVIPVW--LSEKGQDFLRKCLR 300

  Fly   528 VEVDRRATADELLSHPFL----NDCSEVKALVPNIKAAKKVLRRNVXLLCNHRTARLL 581
            .:..:|.|.:|||.||||    ||..:....: |..:...||.:....||....:|.:
plant   301 KDPKQRWTVEELLQHPFLDEEDNDSDQTGNCL-NSSSPSTVLDQRFWDLCETSRSRFI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 80/265 (30%)
S_TKc 293..545 CDD:214567 80/260 (31%)
MAPKKK15NP_001330365.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.