DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and CIPK20

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_199394.1 Gene:CIPK20 / 834622 AraportID:AT5G45820 Length:439 Species:Arabidopsis thaliana


Alignment Length:293 Identity:83/293 - (28%)
Similarity:151/293 - (51%) Gaps:26/293 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 RYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSK----DLILTEIRVLKDFNHKNLVN 352
            :|:..:.:|:|....|:.|.:::....||:|.|| |.:.:|    |.|..||.|::...|.::| 
plant    11 KYELGRLLGQGTFAKVYHARNIKTGESVAIKVID-KQKVAKVGLIDQIKREISVMRLVRHPHVV- 73

  Fly   353 FLDAYLLEPEDQLWVVMEYMDGGPLTDVVTETVMKERQIACVCRETLYAISFLHAKGIIHRDIKS 417
            ||.. ::..:.:::..|||:.||.|.|.|::..:||.......::.:.||.:.|::|:.|||:|.
plant    74 FLHE-VMASKTKIYFAMEYVKGGELFDKVSKGKLKENIARKYFQQLIGAIDYCHSRGVYHRDLKP 137

  Fly   418 DNVLLGMDGSVKVTDFGFCANIEG---DEKRQTMVGTPYWMAPEVVTRKKY-GKKVDIWSIGIMA 478
            :|:||..:|.:|::|||..|..|.   |....|..|||.::||||:.:|.| |.|.|:||.|::.
plant   138 ENLLLDENGDLKISDFGLSALRESKQQDGLLHTTCGTPAYVAPEVIGKKGYDGAKADVWSCGVVL 202

  Fly   479 IEMIEGQPPYLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSH- 542
            ..::.|..|: :|..|..:|.....|.....:|  ..|.::..|.|.|....:.|...::::.: 
plant   203 YVLLAGFLPF-HEQNLVEMYRKITKGEFKCPNW--FPPEVKKLLSRILDPNPNSRIKIEKIMENS 264

  Fly   543 -----------PFLNDCSEVKALVPNIKAAKKV 564
                       |...:..::.:|:.::.||..|
plant   265 WFQKGFKKIETPKSPESHQIDSLISDVHAAFSV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 79/272 (29%)
S_TKc 293..545 CDD:214567 79/271 (29%)
CIPK20NP_199394.1 STKc_SnRK3 11..265 CDD:271133 78/259 (30%)
S_TKc 12..266 CDD:214567 78/259 (30%)
CIPK_C 303..417 CDD:213380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.