DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and AT5G14720

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001330554.1 Gene:AT5G14720 / 831324 AraportID:AT5G14720 Length:674 Species:Arabidopsis thaliana


Alignment Length:289 Identity:102/289 - (35%)
Similarity:150/289 - (51%) Gaps:25/289 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 NSDDPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDM-KNQSSKDLILTEIRVLKDFNHK 348
            |:.|    ||..:|:|.|.|..|..|..:.....||:|.:|: |..:..|.|..|::.:...||.
plant    12 NAKD----YKLYEEIGDGVSATVHRALCIPLNVVVAIKVLDLEKCNNDLDGIRREVQTMSLINHP 72

  Fly   349 NLV----NFLDAYLLEPEDQLWVVMEYMDGGPLTDVVTETV---MKERQIACVCRETLYAISFLH 406
            |::    :|...:      ||||||.||.||....::..:.   .:|..||.:.||||.|:.:||
plant    73 NVLQAHCSFTTGH------QLWVVMPYMAGGSCLHIIKSSYPDGFEEPVIATLLRETLKALVYLH 131

  Fly   407 AKGIIHRDIKSDNVLLGMDGSVKVTDFGF--CANIEGDEK--RQTMVGTPYWMAPEVVTR-KKYG 466
            |.|.||||:|:.|:||..:|:||:.|||.  |....||.:  |.|.||||.||||||:.: ..|.
plant   132 AHGHIHRDVKAGNILLDSNGAVKLADFGVSACMFDTGDRQRSRNTFVGTPCWMAPEVMQQLHGYD 196

  Fly   467 KKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRP--DIKSWDKLSPNLQDFLDRCLQVE 529
            .|.|:||.||.|:|:..|..|:....|::.|.:...|..|  |.:...:.|...::.:..||..:
plant   197 FKADVWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKRFSKAFKEMVGTCLVKD 261

  Fly   530 VDRRATADELLSHPFLNDCSEVKALVPNI 558
            ..:|.|:::||.|||.........||..|
plant   262 PKKRPTSEKLLKHPFFKHARPADYLVKTI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 97/271 (36%)
S_TKc 293..545 CDD:214567 96/266 (36%)
AT5G14720NP_001330554.1 STKc_OSR1_SPAK 14..277 CDD:270787 97/272 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.