DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and AT4G24100

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001328320.1 Gene:AT4G24100 / 828510 AraportID:AT4G24100 Length:725 Species:Arabidopsis thaliana


Alignment Length:269 Identity:96/269 - (35%)
Similarity:147/269 - (54%) Gaps:16/269 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 SDDPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDM-KNQSSKDLILTEIRVLKDFNHKN 349
            |.:|:: ||..:|:|.|||.:|:.|..|.....||:|.:|: :..|:.|.|..|.:.:...:|.|
plant    43 SMNPKD-YKLMEEIGHGASAVVYRAIYLPTNEVVAIKCLDLDRCNSNLDDIRRESQTMSLIDHPN 106

  Fly   350 LVNFLDAYLLEPEDQLWVVMEYMDGGP---LTDVVTETVMKERQIACVCRETLYAISFLHAKGII 411
            ::....::.:  :..|||||.:|..|.   |.........:|..|.||.:|||.|:.:||.:|.|
plant   107 VIKSFCSFSV--DHSLWVVMPFMAQGSCLHLMKTAYSDGFEESAICCVLKETLKALDYLHRQGHI 169

  Fly   412 HRDIKSDNVLLGMDGSVKVTDFGF--CANIEGDEK--RQTMVGTPYWMAPEVV-TRKKYGKKVDI 471
            |||:|:.|:||..:|.:|:.|||.  |....||.:  |.|.||||.||||||: ....|..|.||
plant   170 HRDVKAGNILLDDNGEIKLGDFGVSACLFDNGDRQRARNTFVGTPCWMAPEVLQPGNGYNSKADI 234

  Fly   472 WSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKSWD---KLSPNLQDFLDRCLQVEVDRR 533
            ||.||.|:|:..|..|:....|::.|.:...|..|.: .:|   |.|.:.::.:..||..:..:|
plant   235 WSFGITALELAHGHAPFSKYPPMKVLLMTIQNAPPGL-DYDRDKKFSKSFKEMVAMCLVKDQTKR 298

  Fly   534 ATADELLSH 542
            .||::||.|
plant   299 PTAEKLLKH 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 95/267 (36%)
S_TKc 293..545 CDD:214567 94/262 (36%)
AT4G24100NP_001328320.1 STKc_OSR1_SPAK 47..310 CDD:270787 94/265 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.