DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and AT3G45670

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_190153.1 Gene:AT3G45670 / 823709 AraportID:AT3G45670 Length:379 Species:Arabidopsis thaliana


Alignment Length:382 Identity:96/382 - (25%)
Similarity:163/382 - (42%) Gaps:62/382 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 IPPKPQIKPKPRVTQKFSR--------TSDIRRDEDSDNQHKINTDTI--IIKPAVGAQDAGADD 254
            |||.||   .|.:|.|.|.        :.:|::.:.:....|....:|  .::..:|.....|..
plant    18 IPPLPQ---NPILTVKLSPIILHVRRCSKNIKKKKRTRTPLKKKKKSISSSVESIIGVSFKSASQ 79

  Fly   255 NPDETILRRSKEKRAQKTDAEIYVELRAICNSDDPRERYKTTQEVGKGASGIVFIAADLQN--ES 317
            ....|:.|....|:...     :|:.|.:                |:||.|.|::|....:  ::
plant    80 KHSTTVTRDGGVKKISS-----WVKSRLL----------------GEGAYGCVYLATSKDDIYKT 123

  Fly   318 QVAVKTIDMKNQSSKDLILTEIRVLKDFNHKNLVNFLDAYLLE--PEDQLWVVMEYMDGGPLTDV 380
            :.|:|:.|:....|   ::.|.|:|:......::......:..  ...|..:::||..|..|.|:
plant   124 ERAIKSADVLKAWS---LMHEGRILRSLQSPFVIRCYGHEIAREGTGHQYNLILEYCSGQCLADM 185

  Fly   381 VTETV--MKERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLG-------MDGSV-KVTDFGF 435
            :.:..  :.|..:.....:.|..:|::|.:.|||.:||.||:||.       .:|.: |:.|||.
plant   186 IEDNQGGIPEFDVKQFAIDVLSGLSYIHRRNIIHCEIKPDNLLLSPVDHRFRSNGFLTKIADFGL 250

  Fly   436 CANIEGDEK-----RQTMVGTPYWMAPEVVTRKKYGKKVDIWSIGIMAIEMIEGQPPYLYETPLR 495
              ::|...|     |..|.||..:||||::........|||.:.|...:||:.|:..:.....|.
plant   251 --SMEKGSKEYGNGRGHMRGTTRYMAPELIGGGLLDFAVDICAFGCSVLEMLTGKRVWGEYGDLA 313

  Fly   496 ALYLIAANGRPDI--KSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFLNDCSE 550
            ....:...|..|:  :...:||...||||.|||..|...|.|..||:.||||  ||:
plant   314 HDDWVDLIGHSDLTPQISIRLSAEAQDFLMRCLVKEPGSRWTIGELVDHPFL--CSD 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 73/277 (26%)
S_TKc 293..545 CDD:214567 73/272 (27%)
AT3G45670NP_190153.1 STKc_MAPKKK 96..365 CDD:270783 75/294 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.