DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and S6K2

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001327294.1 Gene:S6K2 / 820019 AraportID:AT3G08720 Length:471 Species:Arabidopsis thaliana


Alignment Length:465 Identity:119/465 - (25%)
Similarity:200/465 - (43%) Gaps:90/465 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 SSGCGSSAGNSNSS--------SINDSSQQSTVPLDALEEVFKEL-----KTNLEHRETLKAAPQ 186
            ||.|  |..|.|.:        |::.|..:|.:. |.||..|.::     :.|.|  |....|..
plant     3 SSQC--SVANKNQTGKPFQKHLSLSISPPKSVLG-DNLELQFSDVFGPMPEANSE--EACDVAYD 62

  Fly   187 EPPPVPPKKSPHTIPPKPQIKPKPRVTQKFSRTS-DIRRDEDSDNQHKINTDTIIIKPAVGAQD- 249
            ||..|..:.  |::     :.|...|:....... .:|..|||     ::....:...::...| 
plant    63 EPAVVYSRS--HSL-----VGPSLVVSHSLKMNKLTLRETEDS-----VDLVECVEGESIKENDE 115

  Fly   250 -AGADDNPDETILRRSKEKRAQKTDAEIYVELRAICNSDDPRERYKTTQEVGKGASGIVFIAADL 313
             :|.||...|    :|.|            |:..:...:|    ::..:.||:||.|.|:.....
plant   116 FSGNDDTDSE----KSPE------------EVSGVVGIED----FEVLKVVGQGAFGKVYQVRKK 160

  Fly   314 QNESQVAVKT-----IDMKNQSSKDLILTEIRVLKDFNHKNLVNFLDAYLLEPEDQLWVVMEYMD 373
            ......|:|.     |..||.:  :.:..|..:|...:|..:|..  .|..:.:.:|::|:::::
plant   161 DTSEIYAMKVMRKDKIVEKNHA--EYMKAERDILTKIDHPFIVQL--KYSFQTKYRLYLVLDFIN 221

  Fly   374 GGPL-TDVVTETVMKERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCA 437
            ||.| ..:..:.:.:|........|.:.|:|.||.|||:|||:|.:|:|:.:||.|.:||||...
plant   222 GGHLFFQLYHQGLFREDLARVYTAEIVSAVSHLHEKGIMHRDLKPENILMDVDGHVMLTDFGLAK 286

  Fly   438 NIEGDEKRQTMVGTPYWMAPEVVTRKKYGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAA 502
            ..|.:.:..:|.||..:||||:|..|.:.|..|.||:||:..||:.|:||:|           .:
plant   287 EFEENTRSNSMCGTTEYMAPEIVRGKGHDKAADWWSVGILLYEMLTGKPPFL-----------GS 340

  Fly   503 NG-------RPDIKSWDKLSPNLQDFLDRCLQVEVDRR-----ATADELLSHPFLNDCS----EV 551
            .|       :..||....||......|...||.|.:||     :.|:|:..|.:....:    |.
plant   341 KGKIQQKIVKDKIKLPQFLSNEAHALLKGLLQKEPERRLGSGPSGAEEIKKHKWFKAINWKKLEA 405

  Fly   552 KALVPNIKAA 561
            :.:.|:.|.|
plant   406 REVQPSFKPA 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 80/274 (29%)
S_TKc 293..545 CDD:214567 79/269 (29%)
S6K2NP_001327294.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.