DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and CIPK16

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_180081.1 Gene:CIPK16 / 817047 AraportID:AT2G25090 Length:469 Species:Arabidopsis thaliana


Alignment Length:284 Identity:79/284 - (27%)
Similarity:139/284 - (48%) Gaps:26/284 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 ERYKTTQEVGKGASGIVFIAADLQNESQVAVKTID----MKNQSSKDLILTEIRVLKDFNHKNLV 351
            ::|...:.:|.|....|:...::.....||:|.|.    .|.:...:.|..||.|::...|.|:|
plant    13 DKYNIGRLLGTGNFAKVYHGTEISTGDDVAIKVIKKDHVFKRRGMMEQIEREIAVMRLLRHPNVV 77

  Fly   352 NFLDAYLLEPEDQLWVVMEYMDGGPLTDVV-TETVMKERQIACVCRETLYAISFLHAKGIIHRDI 415
            ...:  ::..:.:::.||||::||.|.::: .:..:.|.......::.:.|:.|.|::|:.||||
plant    78 ELRE--VMATKKKIFFVMEYVNGGELFEMIDRDGKLPEDLARKYFQQLISAVDFCHSRGVFHRDI 140

  Fly   416 KSDNVLLGMDGSVKVTDFGFCANI--EG--------DEKRQTMVGTPYWMAPEVVTRKKY-GKKV 469
            |.:|:||..:|.:||||||..|.:  ||        |:...|..|||.::||||:..|.| |...
plant   141 KPENLLLDGEGDLKVTDFGLSALMMPEGLGGRRGSSDDLLHTRCGTPAYVAPEVLRNKGYDGAMA 205

  Fly   470 DIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRA 534
            ||||.||:...::.|..|::.|. :..||........:...|..|..  ::.|.|.|..:.::|.
plant   206 DIWSCGIVLYALLAGFLPFIDEN-VMTLYTKIFKAECEFPPWFSLES--KELLSRLLVPDPEQRI 267

  Fly   535 TADELLSHPFLNDCSEVKALVPNI 558
            :..|:...|:..     |...|::
plant   268 SMSEIKMIPWFR-----KNFTPSV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 77/269 (29%)
S_TKc 293..545 CDD:214567 77/267 (29%)
CIPK16NP_180081.1 PKc_like 14..277 CDD:419665 76/267 (28%)
CIPK_C 323..437 CDD:213380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.