DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and CPK16

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_179379.1 Gene:CPK16 / 816299 AraportID:AT2G17890 Length:571 Species:Arabidopsis thaliana


Alignment Length:386 Identity:110/386 - (28%)
Similarity:184/386 - (47%) Gaps:56/386 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 KSPHTIPPKPQIKPKP--------RVT-QKFSRTSDIRRDEDSDNQHKINTDTIIIKPAVGAQDA 250
            ::||..||...:|.:|        .|| ||..||...|      |.....|.|....|....::.
plant    19 RNPHPHPPLTVVKSRPPRSPCSFMAVTIQKDHRTQPRR------NATAKKTPTRHTPPHGKVREK 77

  Fly   251 GADDNPDETILRRSKE-----KRAQKTDAEIYVELRAICNSDDPRERYKTTQEVGKGASGIVFIA 310
            ...:|.     ||..|     ||.....|:            |...||...:.:|.|..|..::|
plant    78 VISNNG-----RRHGETIPYGKRVDFGYAK------------DFDHRYTIGKLLGHGQFGYTYVA 125

  Fly   311 ADLQNESQVAVKTIDMKNQS---SKDLILTEIRVLKDF-NHKNLVNFLDAYLLEPEDQLWVVMEY 371
            .|.:...:||||.||....:   :.:.:..|:::|:.. .|:|:|.|.:|:  |.::.:::|||.
plant   126 TDKKTGDRVAVKKIDKAKMTIPIAVEDVKREVKILQALTGHENVVRFYNAF--EDKNSVYIVMEL 188

  Fly   372 MDGGPLTDVV---TETVMKERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLGM---DGSVKV 430
            .:||.|.|.:   .::...||..|.|.|:.|...:..|.:|::|||:|.:|.|...   |..:|.
plant   189 CEGGELLDRILARKDSRYSERDAAVVVRQMLKVAAECHLRGLVHRDMKPENFLFKSTEEDSPLKA 253

  Fly   431 TDFGFCANIEGDEKRQTMVGTPYWMAPEVVTRKKYGKKVDIWSIGIMAIEMIEGQPPYLYETPLR 495
            ||||....|:..:|...:||:.|::||||:.|:. |.:.|:||||:::..::.|:.|:..:|. .
plant   254 TDFGLSDFIKPGKKFHDIVGSAYYVAPEVLKRRS-GPESDVWSIGVISYILLCGRRPFWDKTE-D 316

  Fly   496 ALYLIAANGRPDI--KSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFL---NDCSEV 551
            .::......:||.  |.|..:|.:.:||:.:.|..:...|.||.:.||||::   .|.||:
plant   317 GIFKEVLKNKPDFRRKPWPTISNSAKDFVKKLLVKDPRARLTAAQALSHPWVREGGDASEI 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 83/268 (31%)
S_TKc 293..545 CDD:214567 81/263 (31%)
CPK16NP_179379.1 STKc_CAMK 107..367 CDD:270687 81/263 (31%)
S_TKc 108..368 CDD:214567 81/263 (31%)
PTZ00184 404..549 CDD:185504
EFh 415..476 CDD:238008
EFh 496..550 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.