DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and AURKC

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001015878.1 Gene:AURKC / 6795 HGNCID:11391 Length:309 Species:Homo sapiens


Alignment Length:297 Identity:81/297 - (27%)
Similarity:145/297 - (48%) Gaps:34/297 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 RAQKTDAEIYVELRAICNSDDPRERYKTTQE------VGKGASGIVFIAADLQNESQVAVKTIDM 326
            :||....|:....:.......|..|..|..:      :|||..|.|::|...::...||:|.: .
Human    12 KAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVL-F 75

  Fly   327 KNQSSKD----LILTEIRVLKDFNHKNLVN----FLDAYLLEPEDQLWVVMEYMDGGPL-TDVVT 382
            |:|..|:    .:..||.:.....|.|::.    |.||      .::::::||...|.| .::..
Human    76 KSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDA------RRVYLILEYAPRGELYKELQK 134

  Fly   383 ETVMKERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANIEGDEKRQT 447
            ...:.|::.|.:..|...|:::.|.|.:||||||.:|:|||..|.||:.|||:..:.. ..:|:|
Human   135 SEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTP-SLRRKT 198

  Fly   448 MVGTPYWMAPEVVTRKKYGKKVDIWSIGIMAIEMIEGQPPY----LYETPLRALYLIAANGRPDI 508
            |.||..::.||::..:.|.:|||:|.||::..|::.|.||:    ..||..|.|       :.|:
Human   199 MCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRIL-------KVDV 256

  Fly   509 KSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFL 545
            :....:....:|.:.|.|:.:...|....::|.||::
Human   257 RFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWV 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 78/275 (28%)
S_TKc 293..545 CDD:214567 76/270 (28%)
AURKCNP_001015878.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 3/20 (15%)
STKc_Aurora-B_like 36..305 CDD:271019 77/273 (28%)
S_TKc 43..293 CDD:214567 75/264 (28%)
Interaction with BIRC5. /evidence=ECO:0000269|PubMed:27332895 292..309 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.