DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and TAOK1

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_065842.1 Gene:TAOK1 / 57551 HGNCID:29259 Length:1001 Species:Homo sapiens


Alignment Length:296 Identity:100/296 - (33%)
Similarity:159/296 - (53%) Gaps:15/296 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 ELRAICNSDDPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDL---ILTEIR 340
            |:..:...:||.:.:...:|:|.|:.|.|:.|.|::....||:|.:....:.|.:.   |:.|::
Human    14 EIAELFFKEDPEKLFTDLREIGHGSFGAVYFARDVRTNEVVAIKKMSYSGKQSTEKWQDIIKEVK 78

  Fly   341 VLKDFNHKNLVNFLDAYLLEPEDQLWVVMEYMDGGPLTDV--VTETVMKERQIACVCRETLYAIS 403
            .|:...|.|.:.:...||  .|...|:||||..|. .:|:  |.:..::|.:||.:....|..::
Human    79 FLQRIKHPNSIEYKGCYL--REHTAWLVMEYCLGS-ASDLLEVHKKPLQEVEIAAITHGALQGLA 140

  Fly   404 FLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANIEGDEKRQTMVGTPYWMAPEVV---TRKKY 465
            :||:..:||||||:.|:||...|.||:.|||..:..   ....:.|||||||||||:   ...:|
Human   141 YLHSHTMIHRDIKAGNILLTEPGQVKLADFGSASMA---SPANSFVGTPYWMAPEVILAMDEGQY 202

  Fly   466 GKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEV 530
            ..|||:||:||..||:.|.:||......:.|||.||.|..|.::| ::.|...::|:|.|||...
Human   203 DGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPTLQS-NEWSDYFRNFVDSCLQKIP 266

  Fly   531 DRRATADELLSHPFLNDCSEVKALVPNIKAAKKVLR 566
            ..|.|::|||.|.|:........|:..|:..|..:|
Human   267 QDRPTSEELLKHIFVLRERPETVLIDLIQRTKDAVR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 94/264 (36%)
S_TKc 293..545 CDD:214567 92/259 (36%)
TAOK1NP_065842.1 STKc_TAO1 2..318 CDD:270805 100/296 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..433
SbcC <442..>877 CDD:223496
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 567..587
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.