DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and oxsr1a

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001092217.1 Gene:oxsr1a / 568602 ZFINID:ZDB-GENE-070620-25 Length:515 Species:Danio rerio


Alignment Length:321 Identity:109/321 - (33%)
Similarity:168/321 - (52%) Gaps:41/321 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 SDDP--------RERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDM-KNQSSKDLILTEIRV 341
            |:||        ::.|:..:.:|.||:.:|..|.....:.:||:|.|:: |.|:|.|.:|.||:.
Zfish     2 SEDPSSQPWSIDKDDYELQEVIGSGATAVVQAAYCKPRKEKVAIKRINLEKCQTSMDELLKEIQA 66

  Fly   342 LKDFNHKNLVNFLDAYLLEPEDQLWVVMEYMDGGPLTDVV---------TETVMKERQIACVCRE 397
            :...:|.|:|::..::::  :|:||:||:.:.||.:.|.:         ...||.|..||.:.||
Zfish    67 MSQCHHPNIVSYYTSFVV--KDELWLVMKLLSGGSVLDFIKYIISKGEHKSGVMDEPSIATILRE 129

  Fly   398 TLYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANIE--GD----EKRQTMVGTPYWMA 456
            .|..:.:||..|.||||:|:.|:|||.||||::.|||..|.:.  ||    :.|:|.||||.|||
Zfish   130 VLEGLEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLATGGDMTRNKVRKTFVGTPCWMA 194

  Fly   457 PEVVTR-KKYGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRP-------DIKSWDK 513
            |||:.: :.|..|.|:||.||.|||:..|..||....|::.|.|...|..|       |.:...|
Zfish   195 PEVMEQVRGYDFKADLWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPCLETGVTDKEMVKK 259

  Fly   514 LSPNLQDFLDRCLQVEVDRRATADELLSHPFLNDCSEVKAL-------VPNIKAAKKVLRR 567
            ...:.:..:..|||.:.::|.||.|||.|.|.........|       .|.|....:.:||
Zfish   260 YGKSFRKMISLCLQKDPEKRPTAAELLKHKFFTKAKNTDYLKEKLLERAPTIGERSRKVRR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 102/288 (35%)
S_TKc 293..545 CDD:214567 100/275 (36%)
oxsr1aNP_001092217.1 STKc_OSR1_SPAK 15..291 CDD:270787 100/277 (36%)
S_TKc 17..291 CDD:214567 100/275 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.