DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and slkb

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001315314.1 Gene:slkb / 562769 ZFINID:ZDB-GENE-030131-1684 Length:969 Species:Danio rerio


Alignment Length:312 Identity:115/312 - (36%)
Similarity:170/312 - (54%) Gaps:21/312 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 ILRRSKEKRAQKTDAEIYVELRAICNSDDPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTI 324
            |.:...||:.::.|        .:....:|.|.::...|:|.||.|.||.|.:.|.....|.|.|
Zfish     9 IFKLGIEKKKKQYD--------HVHRDTNPEEIWEIVGELGDGAFGKVFKAQNKQTGIFAAAKVI 65

  Fly   325 DMKNQSSKDLILTEIRVLKDFNHKNLVNFLDAYLLEPEDQLWVVMEYMDGGPLTDVV--TETVMK 387
            |.|.:...:..:.||.:|...:|.|:|..|||:..  |.:||:::|:..||.:..|:  .|..:.
Zfish    66 DTKTEDELEDYMVEIDILASCDHHNIVKLLDAFYF--ESKLWILIEFCAGGAVDAVMLELERPLT 128

  Fly   388 ERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCA-NIEGDEKRQTMVGT 451
            |.||..||::||.|:.:||...:||||:|:.|:||.:||.||:.|||..| |.:..::|.:.:||
Zfish   129 EPQIRVVCKQTLDALLYLHDNKVIHRDLKAGNILLTLDGDVKLADFGVSAKNTKTVQRRDSFIGT 193

  Fly   452 PYWMAPEVV---TRK--KYGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKSW 511
            |||||||||   |.|  .|..|.||||:||..||:.:.:||.....|:|.|..||....|.:...
Zfish   194 PYWMAPEVVMCETSKDRPYDYKADIWSLGITLIELAQIEPPNHEMNPMRVLLKIAKAEPPTLLQP 258

  Fly   512 DKLSPNLQDFLDRCLQVEVDRRATADELLSHPFLN---DCSEVKALVPNIKA 560
            .|.||..:|||...|:..||.|.:..:||.|||::   |...::.|:...||
Zfish   259 SKWSPEFRDFLKHALEKNVDNRWSTAQLLQHPFVSTVTDSRPLRELIAEAKA 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 106/264 (40%)
S_TKc 293..545 CDD:214567 104/259 (40%)
slkbNP_001315314.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.