DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and dapk3

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_690685.1 Gene:dapk3 / 562194 ZFINID:ZDB-GENE-030131-3026 Length:453 Species:Danio rerio


Alignment Length:313 Identity:83/313 - (26%)
Similarity:149/313 - (47%) Gaps:47/313 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 QKTDAEIYVELRAICNSDDPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQS---- 330
            ::.|.|||               |...:|:|.|...||....:..:.::.|.|.|..:..|    
Zfish     5 RQEDVEIY---------------YDMGEELGSGQFAIVRKCKEKSSGTEYAAKFIKKRRLSSSRR 54

  Fly   331 --SKDLILTEIRVLKDFNHKNLVNFLDAYLLEPEDQLWVVMEYMDGGPLTDVVTE-TVMKERQIA 392
              |::.|..|:.:|::..|.|::...|  :.|.:..:.:::|.:.||.|.|.:.| ..:.|.:..
Zfish    55 GVSREEIEREVNILREIQHSNIITLHD--IFENKTDVILILELVSGGELFDFLAEKESLTEEEAT 117

  Fly   393 CVCRETLYAISFLHAKGIIHRDIKSDNVLLGMDGSV-----KVTDFGFCANIEGDEKRQTMVGTP 452
            ...::.|..:.:||:|.|.|.|:|.:|::| :|.:|     |:.|||....|:...:.:.:.|||
Zfish   118 QFLKQILDGVHYLHSKRIAHFDLKPENIML-LDKNVPNPRIKLIDFGIAHQIKDGNEFKNIFGTP 181

  Fly   453 YWMAPEVVTRKKYGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAA-NGRPDIKSWDKLSP 516
            .::|||:|..:..|.:.|:||||::...::.|..|:|.||....|..|:| |...|.:.:...|.
Zfish   182 EFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSNTSE 246

  Fly   517 NLQDFLDRCLQVEVDRRATADELLSHPFLNDCSEVKALVPNIKAAKKVLRRNV 569
            ..:||:.|.|..:..:|.|.::.|.|.::                |.:.||||
Zfish   247 LAKDFIRRLLVKDPKKRMTIEDSLQHSWI----------------KVIKRRNV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 74/269 (28%)
S_TKc 293..545 CDD:214567 74/264 (28%)
dapk3XP_690685.1 STKc_DAPK 7..275 CDD:271007 78/285 (27%)
S_TKc 13..275 CDD:214567 74/264 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.