DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and nuak1a

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_690066.1 Gene:nuak1a / 561563 ZFINID:ZDB-GENE-041210-122 Length:617 Species:Danio rerio


Alignment Length:276 Identity:78/276 - (28%)
Similarity:143/276 - (51%) Gaps:27/276 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 RERYKTTQEVGKGASGIVFIAADLQNESQVAVKTI---DMKNQSSKDLILTEIRVLKDFNHKNLV 351
            :.||:..:.:|:|..|.|..|.:......||:|:|   .:|::.....|..||.::....|.:::
Zfish    50 KHRYELLETLGRGTYGKVKKAIERHTGRVVAIKSIRKEKIKDEQDMVHIRREIEIMSSLRHPHII 114

  Fly   352 NFLDAYLLEPEDQLWVVMEYMDGGPLTDVVTE-TVMKERQIACVCRETLYAISFLHAKGIIHRDI 415
            :..:.:  |.:|::.:||||...|.|.|.::| ..:.||:.....|:.:.|:.:.|.||::|||:
Zfish   115 SIYEVF--ENKDKIVIVMEYASKGELYDYISERRRLTERETRHFFRQIVSAVHYCHKKGVVHRDL 177

  Fly   416 KSDNVLLGMDGSVKVTDFGFCANIEGDEKRQTMVGTPYWMAPEVVTRKKY-GKKVDIWSIGIMAI 479
            |.:|:||..:|::|:.|||.......|:..||..|:|.:.:||:|..:.| |.:||.|::|::..
Zfish   178 KLENILLDDNGNIKIADFGLSNLYHKDKLLQTFCGSPLYASPEIVNGRPYRGPEVDSWALGVLLY 242

  Fly   480 EMIEGQPPYLYETPLRALYLIAANGR----PDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELL 540
            .::.|..|:......|.:..| :||.    |.       |.:.:..:...|.|..|||||.:::.
Zfish   243 TLVYGTMPFDGGDHQRLIRQI-SNGEYREPPQ-------SSDARGLIRWMLMVNPDRRATVEDIA 299

  Fly   541 SHPFLN--------DC 548
            :|.::|        ||
Zfish   300 NHWWVNWGWKSSVCDC 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 75/263 (29%)
S_TKc 293..545 CDD:214567 74/260 (28%)
nuak1aXP_690066.1 STKc_NUAK 52..304 CDD:270975 75/261 (29%)
S_TKc 53..304 CDD:214567 74/260 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.