DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and taok3b

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_021332191.1 Gene:taok3b / 555650 ZFINID:ZDB-GENE-060526-59 Length:438 Species:Danio rerio


Alignment Length:223 Identity:47/223 - (21%)
Similarity:83/223 - (37%) Gaps:46/223 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FHVSRNQETGDLEGLPAPWVRLMNSQITRDEQDKNPDAAYHAV--KYYNYSIKKKENEVFKPFIT 92
            |.:.|:|...:||....     .||:..|:...|      ||:  :....::|..|.::.|.|  
Zfish   212 FELMRHQHQTELENQEE-----YNSRRQRELHRK------HALERRQQPRNLKTLEMQIKKQF-- 263

  Fly    93 EDVIHEESKEIENYVNYK--NKHKSQDPEKSDDDGSSTATETESSSGCGSSAGNSNSSSINDSSQ 155
            :|....::|:      ||  ..|:.:...|.|......:.:.|.:......| .....|||:...
Zfish   264 QDTCKVQNKQ------YKALRNHQLEVSPKGDHKAILKSLKEEQTRKLAQLA-EQYEQSINEMMA 321

  Fly   156 QSTVPLDALEEV-FKELKTNLEHRETLKAAPQEPPPVPPKKSPHTIPPKPQIKPK-PRVTQKFSR 218
            ..::.||..:|. .:.|:..|.....|..|.|.             ..|.|::.: .|..||..:
Zfish   322 SQSLRLDEEQEAECQALRQQLHQEMELLDAYQN-------------KTKAQMEAQHEREVQKLEQ 373

  Fly   219 TSDIRR-------DEDSDNQHKINTDTI 239
            .:.:||       :|:..:.||..|:.|
Zfish   374 KASLRRAHLEQKIEEELASLHKERTEKI 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166 11/44 (25%)
PKc_like 288..545 CDD:304357
S_TKc 293..545 CDD:214567
taok3bXP_021332191.1 SMC_N <13..>423 CDD:330553 47/223 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.