DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and Stk39

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_062235.1 Gene:Stk39 / 54348 RGDID:621643 Length:553 Species:Rattus norvegicus


Alignment Length:416 Identity:122/416 - (29%)
Similarity:185/416 - (44%) Gaps:101/416 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 AAPQEPPPVPPKKSPHTIPPKPQIKPKPRVTQKFSRTSDIRRDEDSDNQHKINTDTIIIKPAVGA 247
            ||...|.|.|...:|....|.|...|                                 .||..|
  Rat    29 AATSAPAPAPAPAAPAAPAPAPAAAP---------------------------------APAPAA 60

  Fly   248 QDAGADDNPDETILRRSKEKRAQKTDAEIYVELRAICNSDDPRERYKTTQEVGKGASGIVFIAAD 312
            |..|                             ..||     |:.|:..:.:|.||:.:|..|..
  Rat    61 QAVG-----------------------------WPIC-----RDAYELQEVIGSGATAVVQAALC 91

  Fly   313 LQNESQVAVKTIDM-KNQSSKDLILTEIRVLKDFNHKNLVNFLDAYLLEPEDQLWVVMEYMDGGP 376
            ...:.:||:|.|:: |.|:|.|.:|.||:.:...:|.|:|.:..::::  :|:||:||:.:.||.
  Rat    92 KPRQERVAIKRINLEKCQTSMDELLKEIQAMSQCSHPNVVTYYTSFVV--KDELWLVMKLLSGGS 154

  Fly   377 LTDVV---------TETVMKERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTD 432
            :.|::         ...|::|..||.:.:|.|..:.:||..|.||||:|:.|:|||.||||::.|
  Rat   155 MLDIIKYIVNRGEHKNGVLEEAIIATILKEVLEGLDYLHRNGQIHRDLKAGNILLGEDGSVQIAD 219

  Fly   433 FGFCA------NIEGDEKRQTMVGTPYWMAPEVVTR-KKYGKKVDIWSIGIMAIEMIEGQPPYLY 490
            ||..|      ::..::.|:|.||||.||||||:.: :.|..|.|:||.||.|||:..|..||..
  Rat   220 FGVSAFLATGGDVTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADMWSFGITAIELATGAAPYHK 284

  Fly   491 ETPLRALYLIAANGRP-------DIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFLNDC 548
            ..|::.|.|...|..|       |.:...|...:.:..|..|||.:..:|.||.|||...|....
  Rat   285 YPPMKVLMLTLQNDPPTLETGVEDKEMMKKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQKA 349

  Fly   549 SEVKALV-------PNI-KAAKKVLR 566
            ...:.|:       |:| :.||||.|
  Rat   350 KNREYLIEKLLTRTPDIAQRAKKVRR 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 97/280 (35%)
S_TKc 293..545 CDD:214567 96/275 (35%)
Stk39NP_062235.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 9/58 (16%)
STKc_OSR1_SPAK 70..346 CDD:270787 96/277 (35%)
S_TKc 72..346 CDD:214567 96/275 (35%)
Interaction with RELT. /evidence=ECO:0000250|UniProtKB:Q9Z1W9 319..544 19/57 (33%)
Nuclear localization signal. /evidence=ECO:0000255 369..375 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 370..431 5/6 (83%)
Caspase cleavage related site 396..400
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.