DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and Slk

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_006231620.1 Gene:Slk / 54308 RGDID:3780 Length:1234 Species:Rattus norvegicus


Alignment Length:311 Identity:116/311 - (37%)
Similarity:174/311 - (55%) Gaps:20/311 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 ILRRSKEKRAQKTDAEIYVELRAICNSDDPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTI 324
            |.:...||:.::     |..::...|   |.|.::...|:|.||.|.|:.|.:.:.....|.|.|
  Rat     9 IFKLGSEKKKKQ-----YEHVKRDLN---PEEFWEIIGELGDGAFGKVYKAQNKETNVLAAAKVI 65

  Fly   325 DMKNQSSKDLILTEIRVLKDFNHKNLVNFLDAYLLEPEDQLWVVMEYMDGGPLTDVV--TETVMK 387
            |.|::...:..:.||.:|...:|.|:|..|||:..  |:.||:::|:..||.:..|:  .|..:.
  Rat    66 DTKSEEELEDYMVEIDILASCDHPNIVKLLDAFYY--ENNLWILIEFCAGGAVDAVMLELERPLT 128

  Fly   388 ERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCA-NIEGDEKRQTMVGT 451
            |.||..||::||.|:::||...|||||:|:.|:|..:||.:|:.|||..| |....::|.:.:||
  Rat   129 ESQIQVVCKQTLEALNYLHDNKIIHRDLKAGNILFTLDGDIKLADFGVSAKNTRTIQRRDSFIGT 193

  Fly   452 PYWMAPEVV---TRK--KYGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKSW 511
            |||||||||   |.|  .|..|.|:||:||..|||.|.:||:....|:|.|..||.:..|.:...
  Rat   194 PYWMAPEVVMCETSKDRPYDYKADVWSLGITLIEMAEIEPPHHELNPMRVLLKIAKSEPPTLAQP 258

  Fly   512 DKLSPNLQDFLDRCLQVEVDRRATADELLSHPFLNDCSE--VKALVPNIKA 560
            .:.|.|.:|||.:||:..||.|.|..:||.|||:...|.  |:.|:...||
  Rat   259 SRWSSNFKDFLKKCLEKNVDARWTTSQLLQHPFVTVDSNKPVRELIAEAKA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 105/264 (40%)
S_TKc 293..545 CDD:214567 103/259 (40%)
SlkXP_006231620.1 STKc_SLK 28..309 CDD:270811 110/285 (39%)
S_TKc 34..292 CDD:214567 103/259 (40%)
PKK 851..989 CDD:289257
PKK 1019..1159 CDD:289257
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.