DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and stk25a

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_005165982.1 Gene:stk25a / 449653 ZFINID:ZDB-GENE-041010-92 Length:424 Species:Danio rerio


Alignment Length:260 Identity:99/260 - (38%)
Similarity:149/260 - (57%) Gaps:6/260 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 DPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSK-DLILTEIRVLKDFNHKNLV 351
            :|.|.:...:.:|||:.|.|:...:.:.:..||:|.||::....: :.|..||.||...:...:.
Zfish    15 NPEEYFTKLERIGKGSFGEVYKGINNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVT 79

  Fly   352 NFLDAYLLEPEDQLWVVMEYMDGGPLTDVVTETVMKERQIACVCRETLYAISFLHAKGIIHRDIK 416
            .:..:||  ...:||::|||:.||...|::....::|..||.:.||.|..:.:||::..||||||
Zfish    80 KYYGSYL--TGSKLWIIMEYLGGGSALDLLRPGTLEEVYIATILREILKGLDYLHSERKIHRDIK 142

  Fly   417 SDNVLLGMDGSVKVTDFGFCANIEGDE-KRQTMVGTPYWMAPEVVTRKKYGKKVDIWSIGIMAIE 480
            :.||||...|.||:.|||....:...: ||.|.||||:||||||:.:..|..|.||||:||.|||
Zfish   143 AANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIE 207

  Fly   481 MIEGQPPYLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFL 545
            :.:|:||.....|:|.|:||..|..|.::.  ..|...:||::.||..|...|.||.|||.|.|:
Zfish   208 LAKGEPPNAELHPMRVLFLIPKNNPPTLEG--SYSKAFKDFVEACLNKEPRFRPTAKELLKHKFI 270

  Fly   546  545
            Zfish   271  270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 98/258 (38%)
S_TKc 293..545 CDD:214567 96/253 (38%)
stk25aXP_005165982.1 STKc_MST3_like 20..291 CDD:270786 97/255 (38%)
S_TKc 20..270 CDD:214567 96/253 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.