DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and msn

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster


Alignment Length:284 Identity:108/284 - (38%)
Similarity:159/284 - (55%) Gaps:19/284 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 VELRAICNSDDPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDLILTEIRVL 342
            ::|.|:   .||...::..:.||.|..|.|:.....:.....|:|.:|:.....:::.| ||.||
  Fly    20 IDLTAL---KDPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKL-EINVL 80

  Fly   343 KDF-NHKNLVNFLDAYLLE----PEDQLWVVMEYMDGGPLTDVVTET---VMKERQIACVCRETL 399
            |.: ||:|:..:..|::.:    .:||||:||||...|.:||:|..|   .:||..||.:|||.|
  Fly    81 KKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREIL 145

  Fly   400 YAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANIEGD-EKRQTMVGTPYWMAPEVVTRK 463
            ..:|:||:..:||||||..||||..:..||:.|||..|.::.. .:|.|.:||||||||||:...
  Fly   146 RGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACD 210

  Fly   464 K-----YGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLD 523
            :     |..:.|:||:||.|:||.|.|||.....|:|||:||..|..|.:|| .|.|.....|:|
  Fly   211 ENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKS-KKWSKKFHGFID 274

  Fly   524 RCLQVEVDRRATADELLSHPFLND 547
            ..|..:..:|...:.||.|.|:.|
  Fly   275 TVLVKDYHQRPYTENLLKHGFIKD 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 104/270 (39%)
S_TKc 293..545 CDD:214567 102/265 (38%)
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 104/275 (38%)
S_TKc 32..296 CDD:214567 102/265 (38%)
CNH 1183..1484 CDD:214481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48015
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.