DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and MAP3K4

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_005913.3 Gene:MAP3K4 / 4216 HGNCID:6856 Length:1608 Species:Homo sapiens


Alignment Length:461 Identity:122/461 - (26%)
Similarity:202/461 - (43%) Gaps:88/461 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SSTATETESSSGCGSSAGNSNSSSINDSSQQSTVPLDALEEVFKELKTNLEHRETLKAAPQEPPP 190
            ::.|....|.|| |.|....:.||.:|:...|....|.|..:..||:.....|.:.....::.|.
Human  1198 AAVAASRPSPSG-GDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPA 1261

  Fly   191 VPPKKSPHTIPPKPQIKPKPRVTQKFSRTSDIRRDEDSDNQHKINTDTIIIKPAVGAQDAGADDN 255
            .|                              |.|.....:......|:|.:    ::|..:...
Human  1262 YP------------------------------RGDSSGSTRRSWELRTLISQ----SKDTASKLG 1292

  Fly   256 PDETI---LRRSKEKRAQKTDAEIYVELR------AICNSDDPRE--------------RYKTTQ 297
            |.|.|   :|..:|||        |.|:|      .:|  |.|:.              :::...
Human  1293 PIEAIQKSVRLFEEKR--------YREMRRKNIIGQVC--DTPKSYDNVMHVGLRKVTFKWQRGN 1347

  Fly   298 EVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDLILT--EIRVLKDFNHKNLVNFLDAYLLE 360
            ::|:|..|.|:....:.....:|:|.|..:....|.:..|  |:::.:...|.|||.:....|  
Human  1348 KIGEGQYGKVYTCISVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLVRYFGVEL-- 1410

  Fly   361 PEDQLWVVMEYMDGGPLTDVVTETVMKERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLGMD 425
            ..:::::.|||.|.|.|.: |:...::|..|....::...||:.||..||:|||||..|:.|...
Human  1411 HREEMYIFMEYCDEGTLEE-VSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRDIKGANIFLTSS 1474

  Fly   426 GSVKVTDFGFCANIEGDEKRQTM-------VGTPYWMAPEVVTRKK---YGKKVDIWSIGIMAIE 480
            |.:|:.|||....::.:  .|||       :||..:|||||:||.|   :|:..||||:|.:.||
Human  1475 GLIKLGDFGCSVKLKNN--AQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIE 1537

  Fly   481 MIEGQPP-YLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPF 544
            |:.|:.| :.||...:.:|.:....:|.|.  ::|||..:|||..||:.:...|.||.:||.|.|
Human  1538 MVTGKRPWHEYEHNFQIMYKVGMGHKPPIP--ERLSPEGKDFLSHCLESDPKMRWTASQLLDHSF 1600

  Fly   545 LNDCSE 550
            :..|::
Human  1601 VKVCTD 1606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 86/283 (30%)
S_TKc 293..545 CDD:214567 85/264 (32%)
MAP3K4NP_005913.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..136
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 429..478
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1157..1190
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1202..1231 9/29 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1244..1274 5/59 (8%)
STKc_MEKK4 1342..1601 CDD:270796 85/265 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.