DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and snrkb

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_957127.1 Gene:snrkb / 393806 ZFINID:ZDB-GENE-040426-1724 Length:741 Species:Danio rerio


Alignment Length:269 Identity:77/269 - (28%)
Similarity:134/269 - (49%) Gaps:31/269 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 YKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDL----ILTEIRVLKDFNHKNLVNF 353
            |...:.:|||...:|.:|..:.....||||.||  .....||    :|.|:|.:|...|.|:|..
Zfish    16 YDLDRTLGKGHFAVVKLARHVFTGQLVAVKVID--KTKLDDLATGHLLQEVRCMKLVQHPNVVRL 78

  Fly   354 LDAYLLEPEDQLWVVMEYMDGGPLTDVVTETVMKERQIACVCRET--------LYAISFLHAKGI 410
            .:  :::.:.:|::::|..|||.:.|.:.      |....|..:|        :.||::.|...:
Zfish    79 YE--VIDTQTKLYLILELGDGGDMYDYIL------RHEGGVAEDTAKVHFAQIVRAIAYCHRLHV 135

  Fly   411 IHRDIKSDNVL-LGMDGSVKVTDFGFCANIEGDEKRQTMVGTPYWMAPEVVTRKKY-GKKVDIWS 473
            :|||:|.:||: ....|:||:|||||..:.:......|..|:..:.|||::..::| ...|||||
Zfish   136 VHRDLKPENVVFFRQQGTVKLTDFGFSNHFKPGTMLMTSCGSLAYSAPEILLGEEYDAPAVDIWS 200

  Fly   474 IGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKSW--DKLSPNLQDFLDRCLQVEVDRRATA 536
            :|::...::.|.||:........|.:|.     |.:..  :.:|...:|.:.|.||.:..:||:.
Zfish   201 LGVILYMLVCGHPPFQETNDSETLIMIM-----DCRYTVPNHISAQCKDLISRMLQRDPAKRASL 260

  Fly   537 DELLSHPFL 545
            .|:.|||:|
Zfish   261 AEIESHPWL 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 76/267 (28%)
S_TKc 293..545 CDD:214567 76/267 (28%)
snrkbNP_957127.1 STKc_SNRK 12..269 CDD:270976 76/267 (28%)
S_TKc 16..269 CDD:214567 76/267 (28%)
UBA_SNRK 290..335 CDD:270524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.