DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and hppy

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster


Alignment Length:287 Identity:111/287 - (38%)
Similarity:168/287 - (58%) Gaps:16/287 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 DPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDLILTEIRVLKDFNHKNLVN 352
            :|::.|:..|::|.|..|.|:.|..:|:....|:|.|.::......:|..||.:::|..|.|::.
  Fly    21 NPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRDCRHPNIIA 85

  Fly   353 FLDAYLLEPEDQLWVVMEYMDGGPLTDVVTET-VMKERQIACVCRETLYAISFLHAKGIIHRDIK 416
            :..:||  ..|:||:.||:..||.|.|:...| .:.|.|||.:|||||..:.:||:.|.:|||||
  Fly    86 YYGSYL--RRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETLKGLEYLHSMGKMHRDIK 148

  Fly   417 SDNVLLGMDGSVKVTDFGFCANIEGD-EKRQTMVGTPYWMAPEV--VTRK-KYGKKVDIWSIGIM 477
            ..|:||...|.||:.|||..|.|... .||::.:||||||||||  |.|| .|.:..|||:.||.
  Fly   149 GANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWACGIT 213

  Fly   478 AIEMIEGQPPYLYETPLRALYLIAANG--RPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELL 540
            |||:.|.|||.....|:|||:|::.:|  .|.:.:.||.||...:|:...|.....:|.||:.||
  Fly   214 AIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRPTAERLL 278

  Fly   541 SHPFLNDCSEVKALVPNIKAAKKVLRR 567
            .|||: .|.      .:::.||::|::
  Fly   279 QHPFV-QCE------MSLRVAKELLQK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 106/263 (40%)
S_TKc 293..545 CDD:214567 105/258 (41%)
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 105/259 (41%)
S_TKc 26..283 CDD:214567 105/258 (41%)
CNH 869..1184 CDD:279162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.