DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and Myo3b

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001380706.1 Gene:Myo3b / 366069 RGDID:1560313 Length:1333 Species:Rattus norvegicus


Alignment Length:306 Identity:95/306 - (31%)
Similarity:156/306 - (50%) Gaps:28/306 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 SKEKRAQKTDAEIY---------VELRAICNSDDPRERYKTTQEVGKGASGIVFIAADLQNESQV 319
            |.|....||...:|         :.|.::   .||.:.::..:.:|||..|.|:..|:.::.|..
  Rat     8 SGEHAEDKTGKHLYGLFHYNSMMLRLESL---PDPMDTWEIRETIGKGTYGKVYKVANRRDGSLA 69

  Fly   320 AVKTIDMKNQSSKDLILTEIRVLKDF-NHKNLVNFLDAYLLEPE---DQLWVVMEYMDGGPLTDV 380
            |||.:|..|...:: :..|..:|:.. :|.|:|.|...:.....   .|||:|:|..:||.:|::
  Rat    70 AVKILDSVNDVDEE-VEAEYNILQFLPSHPNVVKFYGMFYKADRCVGGQLWLVLELCNGGSVTEL 133

  Fly   381 VTETV-----MKERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANIE 440
            |...:     :.|..|:.:...:|..:..||...|||||:|.:|:||..:|.||:.|||..|.:.
  Rat   134 VKGLLRCGKRLDEALISYILYGSLLGLQHLHHHRIIHRDVKGNNILLTTEGGVKLVDFGVSAQLT 198

  Fly   441 GDE-KRQTMVGTPYWMAPEVVTRKK-----YGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYL 499
            ... :|.|.||||:||||||:..::     |..:.|:||:||.|||:.:|.||.....|::.|:.
  Rat   199 STRLRRNTSVGTPFWMAPEVIACEQQYDSSYDARCDVWSLGITAIELGDGDPPLFEMHPVKMLFK 263

  Fly   500 IAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFL 545
            |..|..|.:...|........|:.:||..:.::|.:...||.|||:
  Rat   264 IPRNPPPTLLHPDNWCEEFNHFISQCLIKDFEKRPSVTHLLDHPFI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 88/271 (32%)
S_TKc 293..545 CDD:214567 86/266 (32%)
Myo3bNP_001380706.1 MYSc_Myo3 373..1062 CDD:276830
IQ 1102..1124 CDD:197470
PKc_like 20..310 CDD:419665 91/294 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.