DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and Stk24

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_038949467.1 Gene:Stk24 / 361092 RGDID:1561742 Length:443 Species:Rattus norvegicus


Alignment Length:278 Identity:106/278 - (38%)
Similarity:158/278 - (56%) Gaps:18/278 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 DPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSK-DLILTEIRVLKDFNHKNLV 351
            ||.|.:...:::|||:.|.||...|.:.:..||:|.||::....: :.|..||.||...:...:.
  Rat    31 DPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVT 95

  Fly   352 NFLDAYLLEPEDQLWVVMEYMDGGPLTDVVTETVMKERQIACVCRETLYAISFLHAKGIIHRDIK 416
            .:..:||  .:.:||::|||:.||...|::....:.|.|||.:.||.|..:.:||::..||||||
  Rat    96 KYYGSYL--KDTKLWIIMEYLGGGSALDLLEPGPLDEIQIATILREILKGLDYLHSEKKIHRDIK 158

  Fly   417 SDNVLLGMDGSVKVTDFGFCANIEGDE-KRQTMVGTPYWMAPEVVTRKKYGKKVDIWSIGIMAIE 480
            :.||||...|.||:.|||....:...: ||.|.||||:||||||:.:..|..|.||||:||.|||
  Rat   159 AANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIE 223

  Fly   481 MIEGQPPYLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFL 545
            :.:|:||:....|::.|:||..|..|.::.  ..|..|::|::.||..|...|.||.|||.|.|:
  Rat   224 LAKGEPPHSELHPMKVLFLIPKNNPPTLEG--SYSRPLKEFVEACLNKEPSFRPTAKELLKHKFI 286

  Fly   546 NDCSEVKALVPNIKAAKK 563
                        |:.|||
  Rat   287 ------------IRNAKK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 101/258 (39%)
S_TKc 293..545 CDD:214567 98/253 (39%)
Stk24XP_038949467.1 STKc_MST3_like 34..307 CDD:270786 104/275 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.