DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and lok

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster


Alignment Length:431 Identity:113/431 - (26%)
Similarity:197/431 - (45%) Gaps:98/431 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 KPRVTQKFSRTS-DIRRDEDSDNQHKINTDTIIIKPAVGAQDAGADDNPDETILRRSKE----KR 268
            |.|:....|..| |:..||.:..:.:.| |.|:.          .:|.|::.:.|.||.    ||
  Fly    50 KYRIIYTHSSFSVDLNNDEFTAGRGEAN-DLILT----------LNDLPEKILTRISKVHFIIKR 103

  Fly   269 AQ-KTDAEIYVE------------------LRAICNSD-----------------DPRE------ 291
            |. :....:|::                  :|.:.|.|                 .|.|      
  Fly   104 ANCELTNPVYIQDLSRNGTFVNNEKIGTNRMRILKNDDVISLSHPTYKAFVFKDLSPNESIGLPE 168

  Fly   292 ----RYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMK---------NQSSKDLILTEIRVLK 343
                .|...:::|.||.|:|.:..|.:...|.|:|.:...         |.|..|.:|.|.:::|
  Fly   169 EINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMK 233

  Fly   344 DFNHKNLVNFLDAYLLEPEDQLWVVMEYMDGGPLTD-VVTETVMKERQIACVCRETLYAISFLHA 407
            :.:|..:|...|  :::..|.:::|:|:|.||.|.: :::..::.|........:..:|:.:||.
  Fly   234 NLSHPCVVRMHD--IVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHD 296

  Fly   408 KGIIHRDIKSDNVLLGMDGS---VKVTDFGFCANIEGDEKRQTMVGTPYWMAPEVVT---RKKYG 466
            :||.|||:|.|||||..:..   :||:|||....::.|...:|:.|||.::||||:.   |:.|.
  Fly   297 RGITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLITGGREAYT 361

  Fly   467 KKVDIWSIGIMAIEMIEGQPPYL--YETPLRALYLIA----ANGRPDIKSWDKLSPNLQDFLDRC 525
            |||||||:|::....:.|..|:.  |.||  |...|.    |.|.|   ||..:|...:..:::.
  Fly   362 KKVDIWSLGVVLFTCLSGTLPFSDEYGTP--AAQQIKKGRFAYGHP---SWKSVSQRAKLLINQM 421

  Fly   526 LQVEVDRRATADELLSHPFLNDCSEVKALVPNIKAAKKVLR 566
            |.|:.:||.:.|::|...:|.|       .|.::.||::::
  Fly   422 LIVDPERRPSIDDVLQSSWLRD-------APMLQKAKRLMK 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 86/288 (30%)
S_TKc 293..545 CDD:214567 84/273 (31%)
lokNP_477219.1 FHA 39..156 CDD:238017 22/116 (19%)
STKc_Chk2 167..441 CDD:270986 84/280 (30%)
S_TKc 174..441 CDD:214567 84/273 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.