DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and Myo3b

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_796350.2 Gene:Myo3b / 329421 MGIID:2448580 Length:1333 Species:Mus musculus


Alignment Length:340 Identity:105/340 - (30%)
Similarity:167/340 - (49%) Gaps:34/340 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 SKEKRAQKTDAEIY---------VELRAICNSDDPRERYKTTQEVGKGASGIVFIAADLQNESQV 319
            |.|....||...:|         :.|.::   .||.|.::..:.:|||..|.|:..|:.::.|..
Mouse     8 SGEHTGDKTGKHLYGLFHYNPMMLGLESL---PDPMETWEIIETIGKGTYGKVYKVANKRDGSLA 69

  Fly   320 AVKTIDMKNQSSKDLILTEIRVLKDF-NHKNLVNFLDAYLLEPE---DQLWVVMEYMDGGPLTDV 380
            |||.:|..:...:: |..|..:|:.. :|.|:|.|...:.....   .|||:|:|..:||.:|::
Mouse    70 AVKVLDPVSDMDEE-IEAEYNILQFLPSHPNVVKFYGMFYKADRCVGGQLWLVLELCNGGSVTEL 133

  Fly   381 VTETV-----MKERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANIE 440
            |...:     :.|..|:.:....|..:..||...|||||:|.:|:||..:|.||:.|||..|.:.
Mouse   134 VKGLLRCGKRLDEAVISYILYGALLGLQHLHCHRIIHRDVKGNNILLTTEGGVKLVDFGVSAQLT 198

  Fly   441 GDE-KRQTMVGTPYWMAPEVVTRKK-----YGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYL 499
            ... :|.|.||||:||||||:..::     |..:.|:||:||.|||:.:|.||.....|::.|:.
Mouse   199 STRLRRNTSVGTPFWMAPEVIACEQQYDSSYDARCDVWSLGITAIELGDGDPPLFEMHPVKMLFK 263

  Fly   500 IAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFLNDCSEVKALVPNIKAAKKV 564
            |..|..|.:...|........|:.:||..:.::|.:...||.|||:.. ::.|.|... |...||
Mouse   264 IPRNPPPTLLHPDSWCEEFNHFISQCLIKDFEKRPSVTHLLDHPFIKG-TQGKVLCLQ-KQLAKV 326

  Fly   565 LR----RNVXLLCNH 575
            |:    ||......|
Mouse   327 LQDQKHRNPVAKTRH 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 89/271 (33%)
S_TKc 293..545 CDD:214567 86/266 (32%)
Myo3bNP_796350.2 STKc_myosinIIIB_N 20..310 CDD:270808 92/293 (31%)
S_TKc 43..309 CDD:214567 86/266 (32%)
MYSc 362..1069 CDD:214580
MYSc_Myo3 373..1062 CDD:276830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.