DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and Stk4

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001101270.1 Gene:Stk4 / 311622 RGDID:1312035 Length:487 Species:Rattus norvegicus


Alignment Length:312 Identity:103/312 - (33%)
Similarity:168/312 - (53%) Gaps:29/312 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 ETI-LRRSKEKRAQKTDAEIYVELRAICNSDDPRERYKTTQEVGKGASGIVFIAADLQNESQVAV 321
            ||: ||....::.:|.|.:...:        .|.|.:...:::|:|:.|.|:.|...:....||:
  Rat     2 ETVQLRNPPRRQLKKLDEDSLTK--------QPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAI 58

  Fly   322 KTIDMKNQSSKDLILTEIRVLKDFNHKNLVNFLDAYLLEPEDQLWVVMEYMDGGPLTDVV--TET 384
            |.:.:  :|....|:.||.:::..:..::|.:..:|....:  ||:||||...|.::|::  ...
  Rat    59 KQVPV--ESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTD--LWIVMEYCGAGSVSDIIRLRNK 119

  Fly   385 VMKERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANI-EGDEKRQTM 448
            .:.|.:||.:.:.||..:.:||....||||||:.|:||..:|..|:.|||....: :...||.|:
  Rat   120 TLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTV 184

  Fly   449 VGTPYWMAPEVVTRKKYGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKSWDK 513
            :|||:||||||:....|....||||:||.||||.||:|||....|:||:::|..|..|..:..:.
  Rat   185 IGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEV 249

  Fly   514 LSPNLQDFLDRCLQVEVDRRATADELLSHPF-------------LNDCSEVK 552
            .|.|..||:.:||....::||||.:||.|||             :|:..:||
  Rat   250 WSDNFMDFVKQCLVKSPEQRATATQLLQHPFVKSAKGAAILRDLINEAMDVK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 94/272 (35%)
S_TKc 293..545 CDD:214567 92/267 (34%)
Stk4NP_001101270.1 STKc_MST1_2 26..281 CDD:132943 93/258 (36%)
Mst1_SARAH 433..480 CDD:402983
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.