DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and Taok3

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001019425.1 Gene:Taok3 / 304530 RGDID:1562861 Length:898 Species:Rattus norvegicus


Alignment Length:298 Identity:101/298 - (33%)
Similarity:152/298 - (51%) Gaps:19/298 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 ELRAICNSDDPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDL---ILTEIR 340
            |:..:...:||.|.:....|:|.|:.|.|:.|.:......||:|.:....:.:.:.   ||.|:|
  Rat    10 EIAELFFKEDPEELFIDLHEIGHGSFGAVYFATNAHTNEVVAIKKMSYSGKQTHEKWQDILKEVR 74

  Fly   341 VLKDFNHKNLVNFLDAYLLEPEDQLWVVMEYMDGGPLTDV--VTETVMKERQIACVCRETLYAIS 403
            .|:...|.|.:.:...||  .|...|:||||..|. .:|:  |.:..::|.:||.:....|..::
  Rat    75 FLQQLKHPNTIEYKGCYL--KEHTAWLVMEYCLGS-ASDLLEVHKKPLQEVEIAAITHGALQGLA 136

  Fly   404 FLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANIEGDEKRQTMVGTPYWMAPEVV---TRKKY 465
            :||...:||||||:.|:||...|.||:.|||..:..   ....:.|||||||||||:   ...:|
  Rat   137 YLHFHSLIHRDIKAGNILLTEPGQVKLADFGSASMA---SPANSFVGTPYWMAPEVILAMDEGQY 198

  Fly   466 GKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKS--WDKLSPNLQDFLDRCLQV 528
            ..||||||:||..||:.|.:||......:.|||.||.|..|.::|  |   :.:.:.|:|.||..
  Rat   199 DGKVDIWSLGITCIELAERKPPLFNMNAMSALYHIAQNDSPTLQSREW---TDSFRRFVDYCLHK 260

  Fly   529 EVDRRATADELLSHPFLNDCSEVKALVPNIKAAKKVLR 566
            ....|..|.|||.|.|:......:.|:..|:..|..:|
  Rat   261 IPQERPAAAELLRHDFIRRERPPRVLIDLIQRTKDAVR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 95/266 (36%)
S_TKc 293..545 CDD:214567 92/261 (35%)
Taok3NP_001019425.1 PKc_like 2..314 CDD:304357 101/298 (34%)
S_TKc 24..277 CDD:214567 92/261 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..372
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..424
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 565..596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.