DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and STK39

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_037365.2 Gene:STK39 / 27347 HGNCID:17717 Length:545 Species:Homo sapiens


Alignment Length:316 Identity:108/316 - (34%)
Similarity:170/316 - (53%) Gaps:39/316 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 ICNSDDPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDM-KNQSSKDLILTEIRVLKDFN 346
            ||     |:.|:..:.:|.||:.:|..|.....:.:||:|.|:: |.|:|.|.:|.||:.:...:
Human    58 IC-----RDAYELQEVIGSGATAVVQAALCKPRQERVAIKRINLEKCQTSMDELLKEIQAMSQCS 117

  Fly   347 HKNLVNFLDAYLLEPEDQLWVVMEYMDGGPLTDVV---------TETVMKERQIACVCRETLYAI 402
            |.|:|.:..::::  :|:||:||:.:.||.:.|::         ...|::|..||.:.:|.|..:
Human   118 HPNVVTYYTSFVV--KDELWLVMKLLSGGSMLDIIKYIVNRGEHKNGVLEEAIIATILKEVLEGL 180

  Fly   403 SFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCA------NIEGDEKRQTMVGTPYWMAPEVVT 461
            .:||..|.||||:|:.|:|||.||||::.|||..|      ::..::.|:|.||||.||||||:.
Human   181 DYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLATGGDVTRNKVRKTFVGTPCWMAPEVME 245

  Fly   462 R-KKYGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRP-------DIKSWDKLSPNL 518
            : :.|..|.|:||.||.|||:..|..||....|::.|.|...|..|       |.:...|...:.
Human   246 QVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDKEMMKKYGKSF 310

  Fly   519 QDFLDRCLQVEVDRRATADELLSHPFLNDCSEVKALV-------PNI-KAAKKVLR 566
            :..|..|||.:..:|.||.|||...|.......:.|:       |:| :.||||.|
Human   311 RKLLSLCLQKDPSKRPTAAELLKCKFFQKAKNREYLIEKLLTRTPDIAQRAKKVRR 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 97/280 (35%)
S_TKc 293..545 CDD:214567 96/275 (35%)
STK39NP_037365.2 STKc_OSR1_SPAK 61..337 CDD:270787 96/277 (35%)
S_TKc 63..337 CDD:214567 96/275 (35%)
Interaction with RELT. /evidence=ECO:0000250|UniProtKB:Q9Z1W9 310..536 19/57 (33%)
Nuclear localization signal. /evidence=ECO:0000255 360..366 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..423 5/6 (83%)
Caspase cleavage related site 387..391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.