DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and sid1

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_593564.1 Gene:sid1 / 2542746 PomBaseID:SPAC9G1.09 Length:471 Species:Schizosaccharomyces pombe


Alignment Length:272 Identity:100/272 - (36%)
Similarity:157/272 - (57%) Gaps:17/272 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 YKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDL--ILTEIRVLKDFNHKNLVN--- 352
            |...:::|.|:.|:|:.|.:..:...:|:|.||::. ...|:  |..|:.:|.:.|..|::.   
pombe     9 YTLLRKLGSGSFGVVWKARENVSGDIIAIKQIDLET-GIDDITDIEQEVFMLSNCNSSNVIQYYG 72

  Fly   353 -FLDAYLLEPEDQLWVVMEYMDGGPLTDVVTETVMKERQIACVCRETLYAISFLHAKGIIHRDIK 416
             |:|.|      .||::||:||||.::.::....:.|:.|:.:.||.||.:::||.:..||||||
pombe    73 CFVDGY------TLWILMEHMDGGSVSGLLKMGRLNEQVISIILREVLYGLNYLHGQNKIHRDIK 131

  Fly   417 SDNVLLGMD-GSVKVTDFGFCANI-EGDEKRQTMVGTPYWMAPEVVTRKKYGKKVDIWSIGIMAI 479
            :.|:||... |:||:.|||..|.: ....:|.|.||||:||||||:.:..||...||||:||.||
pombe   132 AANILLSSSTGNVKLADFGVAAQLSNAASRRHTFVGTPFWMAPEVIQQTSYGLAADIWSLGITAI 196

  Fly   480 EMIEGQPPYLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPF 544
            ||..|.||.....|:|.::.|..:..|.:.  |..||..:||:..||.:..:.|.:|.|||.|||
pombe   197 EMANGIPPRATMHPMRVIFEIPQSEPPKLD--DHFSPTFRDFVSCCLDLNPNMRWSAKELLQHPF 259

  Fly   545 LNDCSEVKALVP 556
            :.....||.::|
pombe   260 IKSAGTVKDIIP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 96/259 (37%)
S_TKc 293..545 CDD:214567 96/259 (37%)
sid1NP_593564.1 STKc_MST3_like 7..279 CDD:270786 100/272 (37%)
S_TKc 9..260 CDD:214567 96/259 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.