DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and Camk1d

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_796317.2 Gene:Camk1d / 227541 MGIID:2442190 Length:385 Species:Mus musculus


Alignment Length:297 Identity:92/297 - (30%)
Similarity:159/297 - (53%) Gaps:26/297 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 SDDPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKD-LILTEIRVLKDFNHKN 349
            ::|.::.::..:.:|.||...|.:|.:.......|||.|..|....|: .|..||.||:...|:|
Mouse    16 AEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHEN 80

  Fly   350 LVNFLDAYLLEPEDQLWVVMEYMDGGPLTD-VVTETVMKERQIACVCRETLYAISFLHAKGIIHR 413
            :|...|.|  |..:.|::||:.:.||.|.| :|.:....|:..:.:.|:.|.|:.:||..||:||
Mouse    81 IVALEDIY--ESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHR 143

  Fly   414 DIKSDNVLL---GMDGSVKVTDFGFCANIEG-DEKRQTMVGTPYWMAPEVVTRKKYGKKVDIWSI 474
            |:|.:|:|.   ..:..:.::|||. :.:|| .:...|..|||.::||||:.:|.|.|.||.|||
Mouse   144 DLKPENLLYYSQDEESKIMISDFGL-SKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSI 207

  Fly   475 GIMAIEMIEGQPPY-------LYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDR 532
            |::|..::.|.||:       |:|..|:|.|..      |...||.:|.:.:||:...::.:.::
Mouse   208 GVIAYILLCGYPPFYDENDSKLFEQILKAEYEF------DSPYWDDISDSAKDFIRNLMEKDPNK 266

  Fly   533 RATADELLSHPFLNDCSEVKALVPNI-KAAKKVLRRN 568
            |.|.::...||::   :...||..|| ::....:|:|
Mouse   267 RYTCEQAARHPWI---AGDTALSKNIHESVSAQIRKN 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 86/269 (32%)
S_TKc 293..545 CDD:214567 85/264 (32%)
Camk1dNP_796317.2 STKc_CaMKI_delta 12..312 CDD:271070 92/297 (31%)
Autoinhibitory domain. /evidence=ECO:0000250 279..319 6/25 (24%)
Calmodulin-binding. /evidence=ECO:0000250 299..320 1/2 (50%)
Nuclear export signal. /evidence=ECO:0000250 318..324
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..385
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.