DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and strd-1

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001022902.1 Gene:strd-1 / 176526 WormBaseID:WBGene00013132 Length:388 Species:Caenorhabditis elegans


Alignment Length:316 Identity:77/316 - (24%)
Similarity:137/316 - (43%) Gaps:51/316 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 KRAQKTDAEIYVELRAICNSDDPRERYKTTQEVGKGASGIVFIAADLQN-ESQVAVKTIDMKNQS 330
            |.|..|:||....|:        ...|...:.:|....|.:::..:.:. :..||:|...:.:..
 Worm    34 KNATITEAEGVPNLK--------ETGYDCVRYMGTCNGGQIYLGRERKKLKDYVAIKKFAIDDVD 90

  Fly   331 SKDLILTEIRVLKDFNHKNLVNFLDAYLLEPEDQLWVVMEYMDGGPLTDVVTETV---MKERQIA 392
            ....|..|...|:..:|.|::...:.::.  |..::.:...|:.|.|.|:|.|.:   :.|:..|
 Worm    91 DYAAIAKESSNLRLMHHPNIIELCECFVY--ERSIYQITPAMNLGSLFDIVFEYMKWGINEKSAA 153

  Fly   393 CVCRETLYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANI--------EGDEKRQTMV 449
            .:.|:.|.|:|:||.:..||||:|..::|:...|:||::.|.|...:        |.|...|..:
 Worm   154 AITRQLLDALSYLHQRRYIHRDLKPKHILIDSSGNVKLSGFRFMIELNHHLDCVFEFDAHLQNQL 218

  Fly   450 GTPYWMAPEVVTRKKYG--KKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANG-------- 504
               |::||||:.:..:|  .|.||:.:||...|.|.|..|:....||..|:. ..||        
 Worm   219 ---YYLAPEVLAQNIHGYTSKSDIYMLGISICEAINGVMPFGELEPLEMLHR-KLNGQVPRPVDM 279

  Fly   505 ---------------RPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFL 545
                           ||......:.|..:.:|:..||..:..:|.:|.:|.|..:|
 Worm   280 ISLKDDQKMGLDISHRPQEHLTRRFSKEMHEFIANCLDYDPQQRGSASDLKSSAWL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 70/293 (24%)
S_TKc 293..545 CDD:214567 70/288 (24%)
strd-1NP_001022902.1 PKc_like 59..329 CDD:304357 67/275 (24%)
S_TKc 64..335 CDD:214567 68/276 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.