DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and Phkg2

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_542151.1 Gene:Phkg2 / 140671 RGDID:620024 Length:406 Species:Rattus norvegicus


Alignment Length:312 Identity:90/312 - (28%)
Similarity:162/312 - (51%) Gaps:32/312 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 ERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDLILTEIRVLKD----------- 344
            ::|.....:|:|.|.:|..........:.|||.:::   |::.|.|.::..::|           
  Rat    22 QKYDPKDIIGRGVSSVVRRCVHRATGDEFAVKIMEV---SAERLSLEQLEEVRDATRREMHILRQ 83

  Fly   345 -FNHKNLVNFLDAYLLEPEDQLWVVMEYMDGGPLTDVVTETV-MKERQIACVCRETLYAISFLHA 407
             ..|.:::..:|:|  |....:::|.:.|..|.|.|.:||.| :.|::...:.|..|.|::|||.
  Rat    84 VAGHPHIITLIDSY--ESSSFMFLVFDLMRKGELFDYLTEKVALSEKETRSIMRSLLEAVNFLHV 146

  Fly   408 KGIIHRDIKSDNVLLGMDGSVKVTDFGFCANIEGDEKRQTMVGTPYWMAPEVV------TRKKYG 466
            ..|:|||:|.:|:||..:..::::||||..::|..||.:.:.|||.::|||::      |...||
  Rat   147 NNIVHRDLKPENILLDDNMQIRLSDFGFSCHLEPGEKLRELCGTPGYLAPEILKCSMDETHPGYG 211

  Fly   467 KKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKS--WDKLSPNLQDFLDRCLQVE 529
            |:||:|:.|::...::.|.||:.:...:..|.:| ..|:....|  ||..|..::|.:.:.|||:
  Rat   212 KEVDLWACGVILFTLLAGSPPFWHRRQILMLRMI-MEGQYQFSSPEWDDRSNTVKDLIAKLLQVD 275

  Fly   530 VDRRATADELLSHPFLNDC--SEVKALVPNIK---AAKKVLRRNVXLLCNHR 576
            .:.|.||::.|.|||...|  |:...|.|..:   |...:|.... .|.:||
  Rat   276 PNARLTAEQALQHPFFERCKGSQPWNLTPRQRFRVAVWTILAAGRVALSSHR 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 80/274 (29%)
S_TKc 293..545 CDD:214567 80/272 (29%)
Phkg2NP_542151.1 STKc_PhKG2 13..291 CDD:271083 80/274 (29%)
Calmodulin-binding (domain-N). /evidence=ECO:0000250 306..330 5/22 (23%)
Calmodulin-binding (domain-C). /evidence=ECO:0000250 346..370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.